KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1404Help
Entry
MGAS10270_Spy1404 CDS       T00355                                 

Definition
(GenBank) Transcriptional regulator, Cro/CI family
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 DUF4447 YdaS_antitoxin CPSase_L_D3 HTH_24 MerR_1 MqsA_antitoxin MarR BetR Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: ABF34469
UniProt: Q1JFU0
Position
1339790..1340176
Genome map
AA seq 128 aa AA seqDB search
MSIDFFQKNIILKGTTMLPEKLKTLRTEAGLTQKELAKIIQTSQQNIAYWEKGSRNPKHK
SIEKLANVFNVSTDYLLGNTDLKNPNDLDIEKVKESLKKSLGYNGTSDIPEDELESMAQA
FIEHFKNQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaatagatttctttcaaaaaaatataattttgaaaggtacaactatgcttccagaa
aaattaaaaacattacgaacagaagctggacttactcaaaaagaattagctaaaattatt
caaactagtcaacaaaatattgcatattgggagaagggtagtagaaatcccaagcataaa
tcaatagaaaaattagctaacgtttttaacgtttctacagattatttattgggaaatact
gatttaaagaatcctaatgatttagacattgaaaaagtaaaagagagcctaaaaaaatct
cttggttacaatggaacttctgatattcctgaagatgagctagaaagtatggcacaagct
tttattgaacactttaaaaatcaataa

DBGET integrated database retrieval system