KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1405Help
Entry
MGAS10270_Spy1405 CDS       T00355                                 

Definition
(GenBank) hypothetical cytosolic protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 Peptidase_M56
Motif
Other DBs
NCBI-ProteinID: ABF34470
UniProt: Q1JFT9
Position
1340183..1340605
Genome map
AA seq 140 aa AA seqDB search
MDLSTVIKKTEDLGITILFCNMPKTKGRYDSTLEKPCIYVDKSLSDIEKINIILHEKMHF
TKNDQSNCLSYISSYSHHIENQAEKDRILDFMNLINEEYPIDESFNYINYMKNACVPEKY
ESYIKNLAKEFYLRNHRKES
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatttatcaactgtaattaaaaaaacggaagatttaggaattactatcttattttgt
aatatgccaaaaaccaaaggaagatatgacagcacacttgaaaagccttgcatttatgtt
gacaaaagtctttcagatatagaaaaaattaacatcattcttcatgaaaaaatgcacttt
acaaaaaatgatcagagtaactgcttatcttatatttcttcatattcacatcatatcgaa
aatcaagctgaaaaagaccgcatattagattttatgaatctaattaacgaagaatatccg
attgatgaatcttttaactatatcaactatatgaaaaatgcttgtgtacctgaaaagtat
gaaagttatatcaaaaatctcgctaaagaattttatctaagaaatcacagaaaagagagc
tag

DBGET integrated database retrieval system