KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1407Help
Entry
MGAS10270_Spy1407 CDS       T00355                                 

Definition
(GenBank) hypothetical cytosolic protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin UCH_N
Motif
Other DBs
NCBI-ProteinID: ABF34472
UniProt: Q1JFT7
Position
complement(1341029..1341367)
Genome map
AA seq 112 aa AA seqDB search
MSDIEVYSVLVSRIEYSDGTGSKVRPAVVVKFNDEVIKTLRLTTKYENKSDNIKSQYLEV
IDWAKANLKRRSWIDTIQYYDLEDKGFNIKIIGKLSDRDIERLKDFLRAKEV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattgaggtatattctgtattagtttcacgtattgaatattctgatggtaca
ggttcaaaggttcgtcctgctgtagtagtcaaatttaatgatgaagtaataaaaacttta
agattaactactaaatatgaaaataagtctgacaatataaaaagtcagtatttagaagtt
attgattgggcaaaagcaaatttaaaaaggcgttcatggattgatacaattcagtactat
gatttagaggacaagggattcaatattaaaattattggtaagttaagtgatagagatatt
gaaagattaaaagattttctcagagcaaaggaagtttag

DBGET integrated database retrieval system