KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1408Help
Entry
MGAS10270_Spy1408 CDS       T00355                                 

Definition
(GenBank) DNA-damage-inducible protein J
  KO
K07473  DNA-damage-inducible protein J
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Brite
KEGG Orthology (KO) [BR:sph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sph02048]
    MGAS10270_Spy1408
Prokaryotic defense system [BR:sph02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    MGAS10270_Spy1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RelB DHOase
Motif
Other DBs
NCBI-ProteinID: ABF34473
UniProt: Q1JFT6
Position
complement(1341364..1341657)
Genome map
AA seq 97 aa AA seqDB search
MSTVAVRVDDQLKDDATELFQSLGLDMSTAVKMFLIQSVKTQSIPFEIKNQSSVSDEEFQ
NLVETKLKGIRVKASDPESVNAFFGDEDFSEYEEYFK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtagcagtaagagttgatgatcaattaaaagatgatgctacagaacttttt
caatccttagggttggatatgagtacagcagtaaaaatgtttttgattcagtctgttaaa
actcaaagtattccttttgaaataaaaaatcaatcatctgtttctgatgaagaatttcaa
aatttggtagaaacaaaattaaaaggaatacgagttaaggctagtgatccagaaagtgta
aatgcgttttttggagatgaagatttttcagaatatgaggaatattttaaatga

DBGET integrated database retrieval system