KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1409Help
Entry
MGAS10270_Spy1409 CDS       T00355                                 

Definition
(GenBank) Transposase
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymosin
Motif
Other DBs
NCBI-ProteinID: ABF34474
UniProt: Q1JFT5
Position
1341678..1341863
Genome map
AA seq 61 aa AA seqDB search
MYNHCITNCNTTQTKKKIVFPSEETLEHCLVTLFNDYNFKQEQRVHKGFGHCTDTLESLF
D
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgtataaccattgtatcactaactgcaatacaacgcaaacaaaaaagaaaatcgtattt
cccagtgaagagaccctagaacactgtctagtcacactatttaatgattacaacttcaag
caagaacaacgagtccacaaaggttttggtcattgtacagacacacttgaaagcctattt
gattaa

DBGET integrated database retrieval system