KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1411Help
Entry
MGAS10270_Spy1411 CDS       T00355                                 

Definition
(GenBank) Transcriptional regulator, AraC family
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC Sigma70_r3
Motif
Other DBs
NCBI-ProteinID: ABF34476
UniProt: Q1JFT3
Position
1345432..1346637
Genome map
AA seq 401 aa AA seqDB search
MVTHMIDSLLLKSLHSLLGLTITVCDQNFSVIREYKSDKTISLFYNHYLILSNFSKTQHD
FLFHYGSLGELFLVHHIQQYYIIIGPWRSNAIDPLLLKKKLTETQINASEQDYFIDRLSQ
LPFFSLSQIRELLIVTNYCLTGVVKDKLSEPLHYYTKGWSNSFDLDKIKQFSKQNMSSYK
YQYHFENNILKAVKSGSEFLLKETVEHFSNSIVPIISGDELRSEKNYSIIIYDRLSQATI
QAGLDIETAYRARDRFIKETESTISLNEVLKLRDTAILFYTQQVDSLKRHLETPHSQTIV
AVIRYLENNLNRFIKTEEIAKECHMSESKLRKLFKQEKHITIQQYFINLKIEAAKQLLDE
NKKVEEVSNLLGFSTSSNFSRTFKKIVGISPLEYKQKLKTI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactcatatgattgattctttattgttgaaatcattacacagtcttctaggtcta
actattactgtttgtgatcaaaatttttctgttatcagagagtataaatccgataaaact
atttcacttttttacaatcattaccttattttaagtaactttagtaaaactcaacatgat
tttttatttcattatggctctttaggagaactttttcttgtccaccatattcaacaatat
tatattatcatcggtccctggcgtagcaatgctattgatcctttacttcttaagaaaaag
ctgactgaaacacaaatcaatgctagtgaacaagactactttattgatagactatcccaa
ttacctttcttctcacttagtcaaatccgagaattactaatagtaaccaattattgtcta
actggggttgtgaaagataaattatcagagcccttacattactacacgaaagggtggagc
aactcctttgatctagataaaattaagcaattttctaaacagaatatgagttcttacaaa
tatcagtatcattttgaaaataatattctaaaagctgttaaatcaggtagtgaatttctt
ttgaaagaaacagtggaacactttagcaattctatcgtacctataatcagtggagatgaa
ttgcgatctgaaaaaaactactccatcattatttatgatcgtctctcacaggctaccatc
caagcaggacttgatatcgaaacagcttatcgagcacgagatcgttttataaaagaaacc
gagtcaactataagtctaaatgaagttttaaaattacgtgatactgctatcttattctat
actcaacaagttgattctttaaaaagacatctcgaaacccctcattctcaaactattgtc
gcagtgattcgatatcttgaaaataatctaaatcgctttattaaaacagaagaaatagct
aaagaatgtcacatgagtgaatcgaagttacgaaaactatttaagcaagaaaaacacatc
actattcaacaatattttataaacttaaaaatcgaagctgctaagcagttactagacgaa
aataagaaagtagaagaagtttccaatttacttggattttccacttcttctaatttttca
aggacatttaaaaaaatagtgggaattagcccactagaatataagcaaaagcttaagaca
atatag

DBGET integrated database retrieval system