KEGG   Sphingomonas sp. YZ-8: D3Y57_04955Help
Entry
D3Y57_04955       CDS       T05706                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
spha  Sphingomonas sp. YZ-8
Brite
KEGG Orthology (KO) [BR:spha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D3Y57_04955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AYJ85501
UniProt: A0A494TI87
Position
unnamed1:755643..757184
Genome map
AA seq 513 aa AA seqDB search
MGLIVFVGLLIVGVVFAAFSVSSDIAASHTGTVAIGAYFLLGLALLIALGFEFVNGFHDT
ANAVATVIYTNALPPTVAVLWSGLWNFLGVLVSSGAVAFGIISLLPVELILQVSGGTGFA
MVFALLIAAIIWNLGTWWLGLPSSSSHTLIGSIIGVGLANQLMRLSSGTSGVDWGKAKDI
GSSLLLSPLLGFACAAILMVVLKTLVKAPALYKEPVGNKPPPLLIRGLLVLTCTLVSFFH
GSNDGQKGMGLIMLILIGTVPTAYALNRAMPQTEVAHFIAIAHQADAALIASGHGVAAPA
DARGAVTAYVQSHTLTPTTLPAIAALSASIGDQVQRYGNLAAVPAGSTANVRNDMYLASE
ALRVLDKSRTVPFSDAQAASLKDFRKSLDASTKFIPNWVKVTVAIALGLGTMVGWKRIVI
TVGEKIGKTHLTYAQGASAEIVAAAMIGAADGFGLPVSTTHVLSSGVAGTMTANGSGLQW
GTLRNMLTAWVLTLPVSILLSGTLFFVFSRVFG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggactaattgtcttcgtcggccttttgatcgtcggtgtcgtgtttgcggcgttcagt
gtttcgagtgacatcgccgcaagccacaccggcactgtcgcaatcggagcctatttcctg
ctcgggctcgcattgctgatcgcgctcggctttgaattcgtgaacggatttcatgacacg
gccaacgcggtcgcaaccgtgatctacaccaacgccctgccaccgacggttgccgtcctg
tggtccgggctgtggaattttctcggcgtattggtgtcgtcgggtgccgttgcgttcggt
atcatctcgcttctaccggtcgaattgatcctgcaggtcagcggcggcaccggctttgcg
atggtctttgcattgttgattgcggcgatcatctggaacctcggaacctggtggctgggt
ttgccgtcctcatcctcgcacacgttgatcgggtcgatcatcggtgtcggcctcgccaat
cagctcatgcgtctgtcgagcggaacatcgggcgtcgactggggcaaagccaaggacatc
ggttcgtcgctcctgctctcaccgttgttgggttttgcctgtgccgccatcctgatggtt
gtgctcaagacccttgtgaaagcgcctgcgttgtacaaggagccggtcggtaacaaaccg
ccgcctctgttgatccgcggcctcctggttttgacctgcacgctcgtttcgttcttccat
ggttcgaacgacggtcaaaagggtatgggcctcatcatgctcatcctgattggcacggtg
ccgacggcttatgcactcaaccgcgcgatgccgcagaccgaagtggcgcattttatcgcc
attgctcatcaggccgatgcggcactcatcgccagcgggcatggcgttgccgcacctgcc
gatgcgcgcggtgccgttaccgcctatgtccagtcgcatactttgaccccgacaacgctg
cccgcgatcgccgctctttccgcctcgattggcgatcaggtccagcgttacggcaatctg
gcagccgttccagcgggttcgacggccaacgtgcgtaacgatatgtacctggcgtccgaa
gcattgcgcgtcctcgataaatcgaggacggtgcccttctccgatgcacaggcggcttcg
ctcaaggatttccgcaaatcgcttgatgcttcgacgaagttcattccaaactgggtgaag
gttaccgtcgccatcgcattaggtctcggcacaatggttggctggaagcggatcgtgatt
acagtcggtgaaaagattggcaaaacacacctgacctacgcacagggtgcctcggcagaa
atcgtggctgcggcaatgatcggcgcagcggacggtttcggcctgccggtatcgaccacc
cacgtcctgtcgtcaggtgttgcgggaacgatgacggcgaatggttccggcctgcaatgg
gggacgctgcgcaatatgctgaccgcatgggtgctgacgttgccggtttcgatcctgctg
tccggcacgctgttctttgtcttcagcagggtcttcggataa

DBGET integrated database retrieval system