KEGG   Sphingomonas sp. YZ-8: D3Y57_07370Help
Entry
D3Y57_07370       CDS       T05706                                 

Gene name
gnd
Definition
(GenBank) decarboxylating 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
spha  Sphingomonas sp. YZ-8
Pathway
spha00030  Pentose phosphate pathway
spha00480  Glutathione metabolism
spha01100  Metabolic pathways
spha01110  Biosynthesis of secondary metabolites
spha01120  Microbial metabolism in diverse environments
spha01130  Biosynthesis of antibiotics
spha01200  Carbon metabolism
Module
spha_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
spha_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:spha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D3Y57_07370 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D3Y57_07370 (gnd)
Enzymes [BR:spha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     D3Y57_07370 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     D3Y57_07370 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD TrkA_N F420_oxidored 3HCDH_N 2-Hacid_dh_C UDPG_MGDP_dh_N Shikimate_DH GFO_IDH_MocA NAD_binding_10 ApbA
Motif
Other DBs
NCBI-ProteinID: AYJ85828
UniProt: A0A494TK81
Position
complement(404345..405325)
Genome map
AA seq 326 aa AA seqDB search
MRIAMIGLGRMGANIARRLMLGKHEVIAFDRNEKAVTDLAGEGAIPAKSLEDIAGKFEGA
PRIFWVMLPAGEPTESTIEAIIKLSSPGDIIIDGGNSFYKDDIRRAKLCSIQGLHYVDVG
TSGGIWGLERGYCMMIGGEDETVKLLDPIFDTLAPGYGTIVRTEGRHSDDDRAERGYIHA
GPAGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKSSEKLPEDERFDINLAEVSEVWRRGS
VISSWLLDLTAIGLAKDPELGHFTGKVADSGEGQWTIDAAMEEAVPVYVLSAALFARYRS
RVDTTFGDKLLSAMRFGFGGHVEMPQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgcaatgatcggtctgggtcgcatgggtgccaacatcgcccgtcgcctgatg
ctcggcaaacatgaagtcattgcattcgaccgtaacgagaaagcagtgacggatctggcg
ggtgagggggccatccccgccaaatcgctcgaggatatagcgggcaaattcgaaggtgcg
ccacggatcttctgggtcatgcttcccgctggcgaaccgacggagagcacgatcgaggct
atcatcaaactatcgtcgcccggagatatcataatcgacggcggcaacagcttttacaag
gatgacatccggcgcgcaaaattatgtagtattcagggcctccactatgtcgacgtcggc
acctccggcggcatctggggtctggagcgcggctattgcatgatgatcggtggcgaggat
gaaaccgtcaaattgctcgatcctatattcgacacccttgcaccgggttatggcacgatc
gttcggaccgaaggccgccattccgacgatgaccgggccgaacgcggctatatccatgca
ggaccagcgggagccggccatttcgtcaagatggtccataacggcatcgaatatggcttg
atgcaggcctatgctgaggggttcgatatcctgaaaggaaaatcctctgaaaaactgcct
gaagacgaacgcttcgatatcaatcttgccgaggtttctgaagtatggcggcgcggaagt
gtgatttcctcatggctgctcgacctgaccgcaatcggattggcgaaggaccccgagctt
gggcatttcaccggcaaggtggcggattccggcgagggtcagtggaccatcgatgccgcg
atggaagaagctgtaccggtatatgtgctgtcggcggcattgttcgctcgctatcgtagc
agggtcgacacaacattcggcgacaagctgttgtccgcaatgcgttttgggttcggcggt
cacgtcgaaatgcctcaatga

DBGET integrated database retrieval system