KEGG   Sphingomonas sp. YZ-8: D3Y57_19650Help
Entry
D3Y57_19650       CDS       T05706                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spha  Sphingomonas sp. YZ-8
Pathway
spha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D3Y57_19650
Enzymes [BR:spha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D3Y57_19650
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D3Y57_19650
    1.1.1.-  
     D3Y57_19650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AYJ87735
Position
2873411..2874439
Genome map
AA seq 342 aa AA seqDB search
MRAADFIDPGTICARTNASRPEPLAGEIIVQVAACGICGSDMHMFRSGTYRDKLIRQTPE
GYQVPGHEFAGTIVALGPGVDGWANGQRVVGVTGQGGGMADYVAVPVNPYQLVAIPDGVS
FEDAATTEPLADGLQMIRKANILTGENIVVFGVGIIGLGVIQGIRARGLDVGALIAVDVH
PARLEAALKAGATHAVNAREGDVFDQIGTITGIEQGYSGTSARIGVVFDCAGYIRHMPGP
PPLETALRLIDLAGGRIVCFGGFEDRVTLELSPLIQKAPTILGSNGYAPEELGEALAMMA
SGKVDRGSLISHRFALDDVAAAFAAQGGADALKVILKMDSAE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcagccgactttatcgatcccggcacgatctgcgctaggacaaatgccagtcgg
cccgaaccgctagcgggcgagataattgtgcaagttgcggcctgcggtatctgcgggtcg
gatatgcacatgtttcgttccggcacttaccgcgacaagctcatccgccaaacacccgaa
ggttatcaggtgccgggccatgagtttgccggcacgatcgtggcattggggcccggcgtg
gatggctgggcgaacggtcagcgtgtggtcggcgtcaccgggcaaggcggtggaatggcg
gactatgtcgcagtgcccgtcaatccataccagttggtggccataccggatggggtgagc
tttgaggatgccgccacaaccgagccgttggccgacggtctgcagatgatccgcaaagcc
aatattctcacaggggaaaatatcgtcgtgtttggcgtcggtatcattggactgggggta
atacagggcatccgtgcccgcggcttggacgtcggtgccctcattgccgtcgatgtccat
cctgcacgattagaagcggcattgaaggcgggagcaacccacgcagtaaatgcccgcgag
ggtgatgtgttcgatcagatcggcacgatcacgggcatcgaacaaggttattccggaaca
tccgcacggatcggcgtggtattcgattgcgcgggttacatccgtcatatgccagggcca
ccaccgctggagacggcgctgcgactgatcgacctcgccggcgggcgtatcgtatgcttc
ggtggatttgaagatcgggtgacgctcgaacttagtcccctgatccagaaggctccaaca
atattggggtctaacgggtatgcaccggaagaattgggcgaggcgctggcaatgatggca
agcggcaaagtcgatcgcggttcattgatttcgcatcgctttgcgctcgacgacgttgca
gcggcctttgctgcccagggcggagcagatgccttgaaagtaatattgaaaatggattca
gcggaatga

DBGET integrated database retrieval system