KEGG   Sphingobium sp. EP60837: EP837_00049Help
Entry
EP837_00049       CDS       T04432                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00010  Glycolysis / Gluconeogenesis
sphb00053  Ascorbate and aldarate metabolism
sphb00071  Fatty acid degradation
sphb00280  Valine, leucine and isoleucine degradation
sphb00310  Lysine degradation
sphb00330  Arginine and proline metabolism
sphb00340  Histidine metabolism
sphb00380  Tryptophan metabolism
sphb00410  beta-Alanine metabolism
sphb00561  Glycerolipid metabolism
sphb00620  Pyruvate metabolism
sphb00625  Chloroalkane and chloroalkene degradation
sphb00903  Limonene and pinene degradation
sphb01100  Metabolic pathways
sphb01110  Biosynthesis of secondary metabolites
sphb01120  Microbial metabolism in diverse environments
sphb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EP837_00049
   00053 Ascorbate and aldarate metabolism
    EP837_00049
   00620 Pyruvate metabolism
    EP837_00049
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP837_00049
   00561 Glycerolipid metabolism
    EP837_00049
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP837_00049
   00310 Lysine degradation
    EP837_00049
   00330 Arginine and proline metabolism
    EP837_00049
   00340 Histidine metabolism
    EP837_00049
   00380 Tryptophan metabolism
    EP837_00049
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EP837_00049
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EP837_00049
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EP837_00049
Enzymes [BR:sphb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     EP837_00049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANI76506
UniProt: A0A173KR97
Position
1:complement(40685..42160)
Genome map
AA seq 491 aa AA seqDB search
MIETRRPSFIDGKRKQLLIDGKHVEALSGETFQSFSPSTGELVAELSLAGGEDVDRAVRA
ARAAFEGSWSRFKPADRQAVLLKLADLVDAEFEDLALLDSIEMGRPITAARGLRGMLQRS
LRHFAGAATAIHGETLSNSFPVDLLSFTLREPVGVVGAIIPWNGPLFSAAWKVGPVLATG
CTVVLKPAEDASLSPLRFGELCLEAGVPPGVVNIVTGAGDTGRALSAHPDVDKIAFTGSC
ETGQRIIAASAGTVKKVTMELGGKSPNIIFADADLDLATPAAAMGVFNNSGQVCAAGTRL
FVERPVYEEMVERIATFAKGLKVGPSLDPDTQIGPLVSAKQYARVSSYLDLGPEEGARLV
TGGRRVTGGDFDKGHWVAPTIFADVKDEMRIAREEIFGPVSCVMPFDDFDEVIGRANATR
FGLAGGVWTRDINKAMTAVKRIRAGSIWVNHYFAMDPSVPFGGYKMSGFGREGGSEHIDA
YLQTKGVWIRT
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagacccgtcgcccttcctttatagatggcaagcgcaagcagctgctgattgac
ggcaagcatgtcgaggcgctgtcaggcgagacattccagagcttcagtccatcgacgggg
gaacttgtggccgaactgtctctggcgggaggggaggatgtggaccgcgcggtccgtgcc
gcgcgggctgccttcgaagggtcttggagccgcttcaagcccgccgaccgacaggcggtg
ctgctgaagctggccgacctggtggatgcggaatttgaagacctcgcgctgctcgattct
atcgagatgggacggccaatcacagcggcacgcggactaaggggcatgctgcagcggtct
ctccggcattttgcgggagccgcgacggcgatccatggcgagacgttgtcgaacagcttt
cccgtcgacctcctgtccttcaccctgcgtgaacccgtgggggtcgtaggcgcaatcatt
ccgtggaacgggccgctgtttagtgctgcctggaaagtcggacctgtgctggcgactggc
tgcaccgtggtattgaagcctgcagaggatgcctcgctcagcccgctgcgctttggagag
ctttgcctggaagcgggcgtgccaccgggggtggtcaacatcgttaccggcgcgggggat
acaggccgagcgctgtcggcgcatccggacgtggacaagatcgcctttacagggtcctgc
gagacgggtcagcggatcatagcggcatccgcaggcaccgtgaagaaagtgacgatggag
ctgggaggcaagtcgccgaacatcatcttcgccgacgcggatctggacctcgccactcca
gcagcagcgatgggtgtgttcaacaattcagggcaagtctgcgctgctggcacgcggctg
ttcgtcgaacggccagtctatgaagaaatggtcgaacggatcgcgacttttgcaaagggt
ctgaaggtcggcccaagcctcgatccggacacgcaaatcgggccgctggtttcggcaaag
caatatgcgcgcgtttcctcctatctcgaccttggcccggaggaaggcgctcgactggtg
acgggcggccggcgggtcactggcggcgatttcgataagggccattgggtcgcaccgacc
atcttcgcggacgtgaaggacgagatgcgcatcgcgcgggaggagattttcgggccggtt
tcctgcgtcatgccctttgatgatttcgacgaagttatcggccgcgccaatgcaacgcgt
ttcgggctagccgggggcgtgtggacgcgcgacatcaacaaggcgatgacagcggtaaaa
cggatccgcgccgggtccatctgggtcaatcactatttcgcgatggacccctccgttccc
tttggcggctacaagatgagcggcttcgggcgcgaaggcggatcagagcatatcgacgcc
tatctgcagacgaagggcgtctggatcaggacctga

DBGET integrated database retrieval system