KEGG   Sphingobium sp. EP60837: EP837_01363Help
Entry
EP837_01363       CDS       T04432                                 

Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00270  Cysteine and methionine metabolism
sphb00920  Sulfur metabolism
sphb01100  Metabolic pathways
sphb01110  Biosynthesis of secondary metabolites
sphb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EP837_01363
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EP837_01363
Enzymes [BR:sphb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     EP837_01363
    2.3.1.46  homoserine O-succinyltransferase
     EP837_01363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase
Motif
Other DBs
NCBI-ProteinID: ANI77791
UniProt: A0A173KV78
Position
1:complement(1392189..1393325)
Genome map
AA seq 378 aa AA seqDB search
MASAPLSDDSRFGLRRQVRLPGPLRLDSGAALAPVDIAYETYGALNEDRSNVVLICHALT
GDQYVASDHPVTGKPGWWWRMVGEGKPVDPARHFIVCANVIGSCMGSSGPASPDPATGEP
YAMRFPVLTIADMVCAQALLLDHLGVGRLSAVIGGSMGGMQALSWPTIFPDRVESCIVIA
STARHSAQNIAFHEVGRQAIMADPNWRGGDYYADAQVPSAGLAVARMAAHITYLSEAGLT
EKFGRRLQGRDAKTFGFDADFQVESYLRHQGLSFVERFDANSYLYITRAMDYYDIADDHG
GSLATAFAPSRARFCLVSFDTDWLYPTAESRAIVHALNASGAQASFVELSSPFGHDAFLL
ECPELNRVVDGFLKGGRA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgccccgctttccgatgacagccgtttcggcctccgccgccaggttcgcctg
cccggccccttgcggctggacagcggcgcggccctcgcgcccgtcgatatcgcctatgaa
acctatggcgcgctgaatgaggataggtccaacgtcgtccttatctgccatgcgctgacc
ggcgaccaatatgtcgcgtccgaccacccggtcaccggcaagcccggctggtggtggcgc
atggtgggggagggcaagcccgtcgatccggcccgccacttcatcgtctgcgccaatgtc
attggcagctgcatgggctcctccggccccgccagccccgatccggcgacgggcgaaccc
tacgccatgcgcttcccggtcctgaccatcgccgatatggtgtgcgcgcaggcgctgctg
ctcgaccatctgggcgtcggccgcctgtctgccgtcatcggcggctccatgggcggcatg
caggcgctgagctggccgaccatcttccccgatcgcgtcgaaagctgcatcgtcatcgcc
tcgaccgcgcgccatagcgcgcagaacatcgctttccacgaagtcgggcgtcaggcgatc
atggccgatcccaactggcgcggtggcgactattatgccgacgcccaggtgccgagcgcg
ggcctcgccgtcgcccgcatggcggcgcacatcacctatctgtccgaagcgggcctcact
gagaaattcggccgtcgccttcaggggcgcgatgcgaaaaccttcgggttcgacgcagac
ttccaggtggaatcctatctgcgccaccagggcctgagcttcgtcgagcggttcgacgcc
aacagctacctctatatcacccgcgccatggactattatgacattgcggatgatcatggc
ggcagcctcgccaccgctttcgctccgtcccgggcgcgcttctgcctggtcagcttcgat
acggactggctctaccccacggcggaatcccgcgccatcgtccacgccctcaatgccagc
ggcgcgcaggcgagcttcgtcgaactgtcgagccccttcggccacgacgccttcctgctc
gaatgtcctgaactcaaccgcgtggtcgatggcttcctgaaaggcggccgcgcatga

DBGET integrated database retrieval system