KEGG   Sphingobium sp. EP60837: EP837_02951Help
Entry
EP837_02951       CDS       T04432                                 

Gene name
butB
Definition
(GenBank) 2-deoxy-scyllo-inosamine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EP837_02951 (butB)
Enzymes [BR:sphb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EP837_02951 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EP837_02951 (butB)
    1.1.1.-  
     EP837_02951 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N 2OG-Fe_Oxy_2 UDPG_MGDP_dh_N GCD14 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ANI79345
UniProt: A0A173L1C6
Position
2:complement(326609..327649)
Genome map
AA seq 346 aa AA seqDB search
MEGTTMRVADFVDPGQVAARGDATRPSPEPGEVIVAVAACGICGSDLHMFRNGAYRDQLV
RATPEGYHVPGHEFAGTIAAVGAGVEGWAVGDRVVGVTGFGGGMADYVAVPVNPFQLVPV
PDGVDMIEAATTEQLADGLQMVRKATIQPGENVAVFGVGIIGLSVIQAIRARGIETGHVI
AIDVHQARLDAARAHGATAAVNARDGDVFDQVAAITGTEEGYQGISARIGAVFDCAGYIK
HMPGPPPLETALRLIDLNGGRIVCFGGYKDRMTIDFGPVIQKQPTIMGSNGYAAEELVEA
LAMMAEGKVDRSALVSHRFPITQAPEAFAAQCAPEAIKVMLTMDRN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaccaccatgcgcgttgccgacttcgtcgatccgggacaggtcgccgcccgc
ggcgacgcgacccgaccttcacccgaaccgggagaggtgatcgtcgcggtcgccgcctgc
ggcatttgcgggtcggacctgcacatgttccgcaacggagcctatcgtgaccagctcgtc
cgcgcgacgccggagggctatcatgtccccggccatgagttcgccggcacgatcgcggcg
gtcggagccggcgtggagggatgggctgtgggcgaccgcgtcgtcggggtcaccggcttt
ggcggcggcatggccgattatgtcgccgtgcctgtcaaccctttccagctcgtgcccgtg
cccgacggtgtcgacatgatcgaggctgcgacgaccgagcagctcgccgacggcctgcag
atggtgcgaaaagcgacgatccagccaggcgaaaatgtcgccgtgtttggggtcggcatc
atcgggctcagcgtcatccaggccattcgcgcgcgcggcatcgaaaccggacatgtaatc
gcgatcgatgtccatcaggcgaggctggacgccgcgcgcgcgcatggcgcgaccgcggca
gtcaacgcacgcgacggggacgtattcgatcaggtggcggcgatcaccggcaccgaagaa
ggctatcagggtatatcggcgcggatcggcgccgtcttcgattgcgccggctatatcaag
catatgccgggcccgccgccgctggaaacggcgctgcgcctcatcgaccttaatggcggg
cggattgtctgcttcggcggttataaggaccgcatgacgatcgacttcggccccgtgatc
cagaagcagccgacgatcatggggtcgaacggctatgcggcggaagaactggtcgaagcg
ctggcgatgatggccgaagggaaggtcgatcggtcggcgctcgtctcccaccgctttccc
atcacgcaggcgccggaggcttttgccgcccaatgcgcgcccgaagcgatcaaggtaatg
ctgacgatggacaggaactga

DBGET integrated database retrieval system