KEGG   Sphingobium sp. EP60837: EP837_03382Help
Entry
EP837_03382       CDS       T04432                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00071  Fatty acid degradation
sphb00072  Synthesis and degradation of ketone bodies
sphb00280  Valine, leucine and isoleucine degradation
sphb00310  Lysine degradation
sphb00362  Benzoate degradation
sphb00380  Tryptophan metabolism
sphb00620  Pyruvate metabolism
sphb00630  Glyoxylate and dicarboxylate metabolism
sphb00640  Propanoate metabolism
sphb00650  Butanoate metabolism
sphb00900  Terpenoid backbone biosynthesis
sphb01100  Metabolic pathways
sphb01110  Biosynthesis of secondary metabolites
sphb01120  Microbial metabolism in diverse environments
sphb01130  Biosynthesis of antibiotics
sphb01200  Carbon metabolism
sphb01212  Fatty acid metabolism
sphb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP837_03382
   00630 Glyoxylate and dicarboxylate metabolism
    EP837_03382
   00640 Propanoate metabolism
    EP837_03382
   00650 Butanoate metabolism
    EP837_03382
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP837_03382
   00072 Synthesis and degradation of ketone bodies
    EP837_03382
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP837_03382
   00310 Lysine degradation
    EP837_03382
   00380 Tryptophan metabolism
    EP837_03382
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EP837_03382
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP837_03382
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP837_03382
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphb04147]
    EP837_03382
Enzymes [BR:sphb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EP837_03382
Exosome [BR:sphb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EP837_03382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANI79766
UniProt: A0A173L0B3
Position
2:complement(804841..805992)
Genome map
AA seq 383 aa AA seqDB search
MPEAYIIDAVRTPVGRKKGSLAHVHPADLGAHPIKELVTRTGIDPSQVEDVVWGCTETIG
GQAGDIGRTAWLVAGLPEEVPGVTVDRQCGSSQQAVHFAAQGVMSGTQDLVVAGGSQAMN
RIPIMAAMIAGAQYGFDSPFIGAKGWDARYGDEEVNQIKSAEMIADKWGISRQAMEEFAL
ASHQRAQAAWDNGWFDKEVAPFEGLGRDETIRPTTTLEGLASLNPVREGGIITAGVASQN
CDAAAALLIASENAVKEHGLKPRARIHHLSVRAANPIWMLTGPIPATQYALKKAGMSIND
IDLFECNEAFASVTMAWMKELDIPHEKVNVQGGAIALGHPIGATGARLMTTLLNALERTG
GRYGLQTMCEGGGQANVTIVERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagcctatatcatcgacgccgtccgcacgcccgtcggccgcaagaagggcagc
cttgcccatgtccaccccgccgaccttggcgcgcacccgatcaaggaactggtgacgcgc
accggcatcgatccttcccaggtcgaggacgtcgtctggggctgcaccgagacgatcggc
ggccaggcgggcgatatcggccgcaccgcctggctggtggcgggcctgcctgaagaagtg
cccggcgtcaccgtcgatcgccagtgcggctcatcgcagcaggcggtgcatttcgccgcg
cagggcgtgatgagcggcacccaggacctggtggtcgcaggcggcagccaggcgatgaac
cgcatcccgatcatggccgcgatgatcgccggcgcccaatatgggttcgacagccccttc
atcggagctaagggctgggacgcgcgctatggcgacgaggaagtcaaccagatcaagtcg
gccgaaatgatcgccgacaaatggggcatcagccgccaggccatggaagagtttgccctt
gcctcgcaccagcgcgcccaggccgcctgggacaatggctggttcgacaaggaagtggca
cccttcgagggccttggccgtgacgagacgatccgccccaccactacgctggaagggctt
gccagcctcaacccggtgcgcgaaggcgggatcatcaccgcgggcgtcgccagccagaat
tgcgacgcggccgctgcgctgctcatcgccagcgaaaatgcggtaaaggagcatggcctc
aaaccccgcgcccgcatccatcatctctcggtccgggccgccaacccgatctggatgctg
accggcccgatccccgccacccaatatgcgctcaagaaggcgggcatgtcgatcaacgac
atcgacctcttcgaatgcaacgaggcctttgccagcgtcaccatggcctggatgaaggaa
ctcgacattccccatgagaaggtcaatgtgcagggcggcgcaatcgcgcttggccacccg
atcggcgcgaccggcgcgcggctcatgaccacgcttttgaacgcccttgagcgcaccggc
ggccgctatggcctccaaacaatgtgcgagggtggcggccaggccaacgtcaccatcgtc
gagcggctgtaa

DBGET integrated database retrieval system