KEGG   Sphingobium sp. EP60837: EP837_03709Help
Entry
EP837_03709       CDS       T04432                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00020  Citrate cycle (TCA cycle)
sphb00640  Propanoate metabolism
sphb00660  C5-Branched dibasic acid metabolism
sphb01100  Metabolic pathways
sphb01110  Biosynthesis of secondary metabolites
sphb01120  Microbial metabolism in diverse environments
sphb01130  Biosynthesis of antibiotics
sphb01200  Carbon metabolism
Module
sphb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sphb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EP837_03709
   00640 Propanoate metabolism
    EP837_03709
   00660 C5-Branched dibasic acid metabolism
    EP837_03709
Enzymes [BR:sphb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EP837_03709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ANI80091
UniProt: A0A173L1V7
Position
pEP1:complement(23536..24147)
Genome map
AA seq 203 aa AA seqDB search
MPAGLFKKGSVGVFSRSGTLTYEAAFKTTNIGPGQTTLVGISGEPVNGTNFKDVPEFVPD
WLPNHVDHHDRRQCGKRNRTVPQGRSGARLKSRAGFNPGRTAHSRGRMGRAGDRLGWPAR
RLRQDRGDGRRRHPRISLAVAVRRNHERGAQESRLVTVIKGENDRGERPTVQESFDRSLM
RRPRSLDVRNVSTNWMMCELRRG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccagccggcctcttcaagaaaggcagcgtcggcgtgttcagccgttccggaacgctc
acctacgaagcggccttcaagaccaccaacattggccccggccagaccactttggtcggc
atcagcggcgaacccgtcaacggcaccaacttcaaagacgtgccggaatttgttcctgac
tggctacccaaccatgtcgatcatcatgatcggcggcagtgcggaaaaagaaaccgcaca
gttcctcaaggacggagcggagcgcggctgaaatcgagggccggcttcaaccccgggcgc
actgcccattcgcgcggccggatgggacgtgccggcgatcgtctcggatggccagcgcgg
cgcctgagacaagatcgcggcgatggaagacgccggcatccgcgtatcagccttgctgtc
gcagttcggcgaaaccatgaaagaggtgctcaagaatctcgcctggtcacggttatcaag
ggcgagaacgacaggggcgagcgaccaactgtgcaagagtcctttgatcgttcgttgatg
cgaagaccacgctctctggacgtgcgaaacgtgtcaacgaattggatgatgtgcgagctg
cgaagaggatga

DBGET integrated database retrieval system