KEGG   Sphingomonas sp. Cra20: CVN68_02415Help
Entry
CVN68_02415       CDS       T05307                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sphc  Sphingomonas sp. Cra20
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CVN68_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATY30982
UniProt: A0A2K8MAR8
Position
complement(557396..558409)
Genome map
AA seq 337 aa AA seqDB search
MHELALPLLIGLIAVALAFDFLNGLHDAANSIATVVATRLLSPVQAVVFAAVFNFAAYFL
TIAVPSLHAVAETIGKGLVDKDVVTPAVIFGALGGAMFWNVLTWMKGIPSSSSHALVGGL
IGAGVAHAGLSGIHWGGLNKTLLAIVLSPTLGMLLAMLVMLVSSWLLMRATARGAERSFR
VLHLISSAAYSLSHGLNDAQKTMGIITVLLYSTGHLTGDFYVPHWVAISCYVAIALGTMT
GGWKIIETMGSRITKLSQHQGFSASLAGSIILFTASALGIPVSTTHTITGSIIGAGTARR
ASAVRWGVAQSVVMAWIITIPASALVGAAFYGLTRLF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaactagccctgcccctgctgatcggcctgatcgccgtcgcgctggcgttcgac
tttctgaacggcttgcacgacgccgccaattcgatcgccacggtggtcgcgacgcgtttg
ctttcgccggtgcaggccgtggtgttcgccgcggtgttcaacttcgccgcttatttcctc
accatcgcggtgccctcgctccacgccgtcgccgagacgatcggcaaggggctggtcgac
aaggatgtcgtcacgccggcggtcatcttcggtgcgctgggcggcgcgatgttctggaac
gtactgacctggatgaagggcatcccctcatcgagcagccacgccctggtcggcggattg
atcggcgccggagtcgcacatgccgggctgagcgggatccactggggcggactcaacaag
accctgctcgcgatcgtgctctcgccgacgctcggcatgttgctggcgatgctcgtcatg
ctcgtcagctcgtggctgctgatgcgcgccaccgcgcggggggccgaacgcagctttcgc
gtgctccatttgatctcctccgccgcctattcgctgagccacggcctaaacgacgcgcag
aagacgatgggcatcatcacggtgctgctctattccaccggccacctgaccggcgacttc
tacgtgccgcactgggtggcgatcagctgttatgtcgcgatcgcgctcggcacgatgacc
ggcggctggaagatcatcgagacgatgggctcgcgcatcaccaaattgtcgcagcaccag
ggcttcagcgcgtcgctggcgggatcgatcatcctgttcaccgcttccgcgctcggcatc
ccggtatcgaccacccataccatcaccggctcgatcatcggcgccggcaccgcgcgccgc
gcctcggcagtgcgctggggcgtcgcgcagagcgtggtgatggcatggatcatcacgatc
ccggcatcggcgctggtcggcgcggccttttacgggctgacccggctcttctga

DBGET integrated database retrieval system