KEGG   Sphingomonas sp. Cra20: CVN68_04080Help
Entry
CVN68_04080       CDS       T05307                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00230  Purine metabolism
sphc00240  Pyrimidine metabolism
sphc01100  Metabolic pathways
sphc01110  Biosynthesis of secondary metabolites
sphc01130  Biosynthesis of antibiotics
Module
sphc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sphc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sphc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CVN68_04080
   00240 Pyrimidine metabolism
    CVN68_04080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sphc04131]
    CVN68_04080
Enzymes [BR:sphc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CVN68_04080
Membrane trafficking [BR:sphc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CVN68_04080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ATY31259
UniProt: A0A2K8MHM2
Position
937506..937928
Genome map
AA seq 140 aa AA seqDB search
MAATRTFSIIKPDATRRNLTGAVTRMLEEGGLRVVASKRIQMTREQAEGFYAVHKERPFF
NDLVEFMISGPVVVQVLEGENAMQRNRDIMGATNPANAEPGTIRKELAESIEANSVHGSD
SDENAAIEIAYFFKPEEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacccggaccttttcgatcatcaagcccgatgccactcgccgcaacctgacc
ggtgcggtcaccaggatgctcgaggagggcggcctgcgcgtcgtcgcctcgaagcgcatc
cagatgacccgcgagcaggccgagggcttctacgcggtccacaaggagcgccccttcttc
aacgatctggtcgagttcatgatctcgggtccggtcgtggtgcaggtgctcgagggcgag
aacgcgatgcagcgcaatcgcgacatcatgggcgcgaccaacccggccaatgccgagccc
ggcacgatccgcaaggaactggcggagtcgatcgaggcgaattcggtccacggttcggac
tcggacgagaatgcggcgatcgagatcgcctatttcttcaagccggaagagattgtcggc
tga

DBGET integrated database retrieval system