KEGG   Sphingomonas sp. Cra20: CVN68_04865Help
Entry
CVN68_04865       CDS       T05307                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00450  Selenocompound metabolism
sphc00970  Aminoacyl-tRNA biosynthesis
sphc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CVN68_04865
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CVN68_04865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sphc01007]
    CVN68_04865
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sphc03016]
    CVN68_04865
Enzymes [BR:sphc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CVN68_04865
Amino acid related enzymes [BR:sphc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CVN68_04865
Transfer RNA biogenesis [BR:sphc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CVN68_04865
 Prokaryotic type
   Other AARSs
    CVN68_04865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ATY31393
UniProt: A0A2K8MC09
Position
1088005..1089507
Genome map
AA seq 500 aa AA seqDB search
MADPFYISTAIHYPNGRPHIGHAYEMIAADAIARFQRQHGRDVFFQTGTDEHGLKMVQTA
RARDMEPRELADEMSIYFREMADVLDISYDRFIRTSEPGHYAASQAIWQAMADAGDLYLD
RYEGWYSVRDEAFYEEKELTDGEGGVKLSPQGTPVEWTAEETWFFKLSKYQQPLLDFYAA
NPDFIRPESRRNEILRFVEGGLIDLSVSRTSFDWGVPVPGSPDHVMYVWVDALTNYITGA
GYPDDPERFAKFWPADIHLIGKDIVRFHAVYWPAFLMSANLPLPKQVFGHGFLLNRGEKM
SKSVGNVVDPMQLAELYGKDALRYFLLRDVSFGHDGTFSDEAIVTRANADLSNSFGNLAQ
RVLAFIAKNCEGHVPEGRAEEADAVLLAEVDVACAAFRTAFDDLALSQGIEAWMTGVFAC
NQYIDGQAPWALRKTDAERMNAVLRTLLRAIRRLATTILPVIPTSAGKLLLELPSEADED
FRIAPPTPIFPRLELQASDA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcccttctacatctcgacagcaatccactatcccaatggccgcccgcatatc
ggccacgcctatgagatgatcgccgccgacgcgatcgcgcgcttccagcgccagcacggc
cgcgacgtcttcttccagaccggcaccgacgagcacggcctcaagatggtccagaccgcg
cgcgcccgcgatatggaaccgcgcgagctcgcggatgaaatgtctatctatttccgtgag
atggccgacgtcctcgatatttcgtacgatcgtttcatccgcacctcggagcccggacat
tacgccgccagccaggcgatctggcaggcgatggccgatgccggcgatctctatctcgat
cgctacgagggctggtattcggtccgcgacgaggctttctacgaagaaaaggaactgacc
gacggggaagggggcgtgaagctctcgccgcagggcactccggtcgaatggaccgcggag
gagacctggttcttcaagctctccaaataccagcagccgttgctcgatttctacgccgcc
aatccggacttcatccgccccgaatcgcgccgcaacgagatcctccgcttcgtcgaaggc
gggctgatcgacttgtcggtcagccgcaccagcttcgactggggcgtgccggtgccgggg
tctcccgatcacgtcatgtatgtctgggtcgatgcgctgaccaactatatcaccggtgcg
ggctatcccgacgatcccgagcgcttcgccaaattctggcccgccgacatccacctgatc
ggcaaggacatcgtccgcttccatgcggtctattggcccgccttcctgatgtcggccaac
ctcccgctgccgaagcaggtgttcggccacgggttcctgctcaaccgcggggagaagatg
tccaagtcggtcggcaacgtcgtcgatccgatgcagctcgccgaactctatggcaaggat
gcgctgcgctatttcctgctgcgtgacgtcagcttcgggcacgacggcacattcagcgac
gaagcgatcgtcacccgcgccaatgccgatctgtcgaacagcttcggtaatctcgcccag
cgcgtgctcgccttcatcgccaagaattgcgagggtcatgtgcccgaggggagggcggag
gaggcagacgccgtgctcctcgccgaggtagacgtcgcctgcgcggcgttccgcacggcg
ttcgacgatcttgcgctgagccagggcatcgaggcgtggatgaccggcgtcttcgcctgc
aatcaatatatcgacgggcaggcgccatgggcgctgcgcaagaccgacgcggaacggatg
aacgcggtgctgcgcaccttgctccgcgcgatccgccggctcgccacgacgatcctgccg
gtaattcccacttcggcgggcaagcttctgcttgaactcccgtccgaggccgacgaggac
ttccgcatcgcgccgccgacccccatcttcccgcgactggaattgcaggcgagcgacgcg
tga

DBGET integrated database retrieval system