KEGG   Sphingomonas sp. Cra20: CVN68_05380Help
Entry
CVN68_05380       CDS       T05307                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00020  Citrate cycle (TCA cycle)
sphc00480  Glutathione metabolism
sphc01100  Metabolic pathways
sphc01110  Biosynthesis of secondary metabolites
sphc01120  Microbial metabolism in diverse environments
sphc01130  Biosynthesis of antibiotics
sphc01200  Carbon metabolism
sphc01210  2-Oxocarboxylic acid metabolism
sphc01230  Biosynthesis of amino acids
Module
sphc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sphc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVN68_05380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CVN68_05380
Enzymes [BR:sphc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CVN68_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh SHQ1
Motif
Other DBs
NCBI-ProteinID: ATY31481
UniProt: A0A2K8MJV6
Position
1185732..1186952
Genome map
AA seq 406 aa AA seqDB search
MAKIKVATPVVEIDGDEMTRIIWQWIRERLILPYLDIDLKYYDLGVEKRDETNDQITIDS
ANAIRQYGVGVKCATITPDEQRVEEFGLKEMWKSPNGTIRNILGGVIFREPIVISNVPRL
IPGWTRPIVVGRHAFGDQYKATDFKVPGKGKLTMKWEGENGETIEKEVFNFPDAGVAMGM
YNLDESITDFARASMNYSLGRGWPLYLSTKNTILKAYDGRFKDIFQAVFDAEFKDQFKEA
GIVYEHRLIDDMVASALKWHGEFVWACKNYDGDVQSDQVAQGFGSLGLMTSVLMSPDGKT
IEAEAAHGTVTRHYRQHQQGKATSTNPIASIFAWTGGLKYRGKFDDTPDVTRFAETLEQV
CIKTVESGAMTKDLALLIGPDQAWMTTEQFFETVRVNLENEMGSWQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggttgcaacgccggtcgtggagatcgacggcgacgagatgacgcgg
atcatctggcagtggatccgcgagcgcctgatcctcccctatctcgacatcgacctcaaa
tattacgatctcggcgtcgaaaagcgcgacgagaccaacgatcagatcacgatcgattcg
gccaacgcgattcggcagtacggcgtcggcgtgaagtgcgcgacgatcactccggacgaa
cagcgcgtcgaagaattcggcctcaaggaaatgtggaagtcgcccaacggcacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtgatctcgaacgtgccgcggctg
attcccggctggactcgcccgatcgtcgtcggccgccacgcgttcggcgaccaatataaa
gctaccgacttcaaggtgcccggcaagggcaagctcacgatgaagtgggaaggcgagaac
ggcgagacgatcgagaaggaagtgttcaacttccccgacgccggcgtcgcgatgggcatg
tacaatctcgacgaatcgatcaccgatttcgcccgcgccagcatgaactattcgctcggc
cgcggctggccgctctacctctcgaccaagaacaccatcctcaaggcctatgacgggcgc
ttcaaggatatcttccaggcggtgttcgacgccgagttcaaggatcagttcaaggaagcg
ggcatcgtctacgagcaccgcctgatcgacgacatggtcgcttcggcgctcaagtggcat
ggcgagttcgtctgggcgtgcaagaattatgacggcgacgtccagtcggaccaggtcgcg
cagggcttcggttctcttggcctgatgacctcggtgctgatgtcgcccgacggcaagacg
atcgaggccgaggcggcgcacggcaccgtcacacgccattatcgccagcaccagcagggc
aaggcaacttcgaccaacccgatcgcatcgattttcgcctggaccggcggcctgaagtat
cgcggcaagttcgacgacacgccagacgtcacgcgcttcgccgaaactctcgagcaggtc
tgcatcaagaccgtcgagagcggcgcgatgaccaaggacctcgcattgctgatcgggccg
gatcaggcgtggatgaccaccgagcagttcttcgagacggttcgtgtcaatctcgagaat
gaaatgggcagctggcagtaa

DBGET integrated database retrieval system