KEGG   Sphingomonas sp. Cra20: CVN68_17310Help
Entry
CVN68_17310       CDS       T05307                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00670  One carbon pool by folate
sphc01100  Metabolic pathways
sphc01120  Microbial metabolism in diverse environments
sphc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CVN68_17310
Enzymes [BR:sphc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CVN68_17310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ATY33506
UniProt: A0A2K8MLQ6
Position
complement(3803391..3804260)
Genome map
AA seq 289 aa AA seqDB search
MSIPQIHPAWDKPPAGVTDGYSLEMTAKDVPALRAAAPRIAPETPIAITFLPNETMDARI
AAAAEVRALGFEPMPHLSARRIASRAELEAIVAGTVAEAGVKRVFLVAGDPPVPAGPFED
TMALLRTGLFERNGITAVGVAGHPEGHPTMSEAQCWEALEIKRAEITARGMATLIVTQFG
FDADPFIAWLLALRARGIDAPVRIGVPGPAGIKTLLRYAAHCGVGASASVMTKYGVSITR
LLGTAGPDKLVDRLAARLTPVHGPVRLHFYPFGGLERTVDWIEDYAGKG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattccgcagatccatcccgcatgggacaagccgcccgcaggcgtgaccgacggc
tattcactcgagatgactgccaaggacgtgccggcgctccgcgccgcagcaccccggatc
gcgcccgaaaccccgatcgcgatcactttcctgcccaacgagacgatggatgcccgtatc
gccgccgcggccgaggtgcgtgcgctggggttcgagccaatgccgcatttgtccgcgcgc
cggatcgcctcgcgcgcggagctcgaggcgatcgtcgcggggacggtcgccgaggccggc
gtcaagcgcgtgttcctggttgccggcgatccgccggtgcccgccgggccgttcgaagac
acgatggcgctgctgcgcaccggattgttcgagcgcaacggcatcaccgcggtcggcgtc
gccgggcatccggagggacacccgacgatgagcgaagcgcaatgctgggaagcgctggag
atcaagcgcgccgagatcacagcgcgcggcatggcgaccttgatcgttacccagttcggc
ttcgacgccgacccgttcatcgcctggctgctggcgctgcgcgcgcgcggcatcgacgcg
ccggtgcggatcggcgtgcccgggccggcggggatcaagacactgctgcgctacgccgcg
cattgcggcgtcggcgcttctgcaagcgtgatgacgaaatatggcgtgtcgatcacgcgg
ctgctggggaccgccgggccggacaagctggtcgatcgcctcgccgcccgactgaccccg
gtgcacggcccggtgcggctgcatttctatcccttcggcgggctcgaacgcaccgtcgac
tggatcgaggactacgccggcaagggctga

DBGET integrated database retrieval system