KEGG   Sphingomonas wittichii DC-6: HY78_10255
Entry
HY78_10255        CDS       T05200                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15061  OH-DDVA oxygenase
Organism
sphd  Sphingomonas wittichii DC-6
Pathway
sphd00627  Aminobenzoate degradation
sphd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HY78_10255
SSDB
Motif
Pfam: LigB NICE-3
Other DBs
NCBI-ProteinID: ARR53779
Position
complement(2123282..2124304)
AA seq 340 aa
MAEIVLGIWTTHGPTLSTTPEQWLLRLPADRARGNHHFRGATYDFDALVALRDDERLAEQ
ASLAERTRRAEACQAAIRTLADIYERARIDVAVIFGNDQHELFTEALMPAFTIFNGPTIW
NEPASAEQARKMAPGIHEAEAGHNPEVYTEYPGAPELADHIIRQAVSDQFDVTRCARLPE
QPGHWSSGIGHAFGFVYRRIMRDRVPPNVPIVTNTFFPPNQPSARRCFELGRSVARAIRS
WPGDARIAVFGSGGMSHFVIDEAFDRHLFDALQARDAEALCTIGEEHLQSGTSELKNWIA
AAGCLFDTPLSGGIVDYQPCYRSEAGTGTANGFMAWTQGG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgagatcgtcctcggaatctggaccacgcacgggccgaccctgtcgaccacgccc
gagcagtggctgctccggctgcccgcagaccgggcgcgcggcaatcaccatttccggggc
gcgacctatgatttcgacgcgctggtcgcgttgcgggacgacgagcggctggccgagcag
gcctcgctcgccgagcgcacccgccgcgcggaggcgtgccaggccgcgatccgtacgctg
gcggacatctacgaacgcgcccggatcgacgtcgcggtgatcttcggcaacgaccagcac
gagctgttcaccgaggcgctgatgccggccttcaccatcttcaacggcccgaccatctgg
aacgagccggccagcgccgaacaggcgaggaagatggcgcccggcatccacgaggccgag
gcggggcacaatcccgaagtctataccgaatatcccggggcgcccgaactggccgaccat
atcatccgccaggcggtgtcggaccagttcgacgtgacgcgctgcgcccggctgcccgag
cagcccgggcattggagcagcggcatcggccacgccttcggcttcgtctatcgccggatc
atgcgcgatcgggtcccgcccaacgtcccgatcgtgaccaacaccttctttccgcccaac
cagccgtcggcgcggcgctgcttcgagctgggccggtcggtggcgcgggcgatccgttcc
tggcctggcgacgcccgcatcgcggtgttcggatcgggcggcatgagccatttcgtgatc
gacgaggcgttcgatcgccacctgttcgacgccttgcaggcgcgcgacgccgaggcgctg
tgcacgatcggggaggagcatctccagtcgggcacctcggagctcaagaactggatcgcg
gcggcgggctgcctgttcgacacgccgttgtcgggcggcatcgtcgactatcagccctgc
taccgatcggaagcgggcactggcacggccaacggattcatggcctggacacagggagga
tga

DBGET integrated database retrieval system