KEGG   Sphingomonas sp. FARSPH: DM480_14040Help
Entry
DM480_14040       CDS       T05685                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sphf  Sphingomonas sp. FARSPH
Pathway
sphf00450  Selenocompound metabolism
sphf00970  Aminoacyl-tRNA biosynthesis
sphf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DM480_14040
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM480_14040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sphf01007]
    DM480_14040
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sphf03016]
    DM480_14040
Enzymes [BR:sphf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DM480_14040
Amino acid related enzymes [BR:sphf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DM480_14040
Transfer RNA biogenesis [BR:sphf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DM480_14040
 Prokaryotic type
   Other AARSs
    DM480_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AXJ96440
UniProt: A0A345WRY8
Position
2964192..2965748
Genome map
AA seq 518 aa AA seqDB search
MADPYYITTAIHYPNGRPHIGHAYEMIAADAIARFQRQAGRDVRFQTGTDEHGLKMAQTA
RARGMETRAFADEMSSYFSDMASKLDISHDRFIRTVEPDHYAASQAIWRAMEANGDLYLD
RYEGWYSVRDEAFYDEKELVAGEGGQRLSPQGTPVEWTAEETWFFRLSNYQQPLLDFYAA
NPDFIRPESRRNEVLRFVEGGLSDLSVSRTSFDWGVPVPDSPGHVMYVWVDALTNYLTGA
GYPDDTATMARYWPADLHLIGKDITRFHTVYWPAFLLSAKLPPPRQVFAHGFLLHRGEKM
SKSLGNVVGPDELTEAFGVDAVRYFLLREVSFGQDGSYSAEAIVTRVNAELANSFGNLAQ
RTLSFIAKNLGGALPEAGRADPADAMLIEEVVVACAGLRAAFGDLMLSQGIEAWMRGVFA
CNQYIDAQAPWALRKTDPDRMHAVLGTLVRAIRMLAIAIMPVVPASAGKVLDQLGATERD
HAAIDDDGWYGRQVASGFVMAAPSPVFPRLELPTTEAA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccctattacatcaccaccgcgatccattatccgaacggccgcccgcacatc
ggtcatgcttatgagatgatcgcggccgatgcgatcgcgcggttccagcggcaggcgggg
cgcgatgtccggttccagacgggcaccgacgaacacggcctgaagatggcgcagaccgcg
cgcgcacgcggcatggaaacgcgtgcctttgcggatgagatgtcgtcgtatttcagtgac
atggcgagcaagcttgatatcagccatgatcgtttcatccgcacggtggagcccgatcac
tacgcggccagccaggcgatctggcgcgcgatggaagcgaacggcgacctgtatctggac
cgctacgagggttggtattcggtccgcgacgaagccttctatgacgagaaggaactggtg
gcgggggaagggggccagcgcctgtcgccgcaaggcacgccggtcgagtggaccgccgaa
gagacgtggttcttccgcctgtccaactatcagcagcccctgctcgatttctacgccgcc
aaccccgatttcatccgtcccgaaagccgccgcaacgaggtgttgcgcttcgtcgagggc
ggcctgtccgacctgtcggtatcgcgcaccagcttcgactggggcgtgcccgttcccgat
agcccggggcacgtcatgtacgtgtgggtcgacgcgctgaccaattacctgaccggcgcc
ggctatccggacgatacggcgacgatggcgcgatactggccggccgacctgcatttgatc
ggcaaggacatcacgcgctttcacacggtttactggcccgccttcctgctgtcggcaaag
ctgccgccgccgcgccaggtgttcgcgcacgggtttctgctgcaccgcggcgagaaaatg
tcgaaatcgctcggaaacgtggtgggaccggacgagttgaccgaggcgttcggcgtcgat
gcggtccgctatttcctgctccgcgaggtcagcttcgggcaggatggcagttattcggcg
gaagcgatcgtgacgcgcgtcaacgccgaactcgccaacagtttcggcaatctggcgcag
cggactctctcgttcatcgccaagaatctgggcggcgcgctgccggaggcggggcgtgcc
gatccggcggacgccatgctgatcgaggaggtcgtcgtcgcgtgcgcgggattgcgggct
gcgttcggcgacctgatgctgagccaggggatcgaggcgtggatgcgcggcgtgttcgcc
tgcaaccagtatatcgacgcacaggcgccctgggcgttgcgcaagaccgatccagaccgg
atgcacgccgtgctcggtacgttggtgcgcgccatccgcatgctggcgatcgccatcatg
ccggtggtgcccgcgtcggccggcaaggtgctcgaccagcttggtgcgaccgagcgcgat
catgccgcgatcgacgacgacggctggtacggccggcaggtagcgtcaggcttcgtgatg
gcggcgccatcgccggtctttccgcggctcgaactgccgacgaccgaggcggcgtga

DBGET integrated database retrieval system