KEGG   Sphingorhabdus sp. M41: AZE99_07915Help
Entry
AZE99_07915       CDS       T04317                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00010  Glycolysis / Gluconeogenesis
sphg00020  Citrate cycle (TCA cycle)
sphg00620  Pyruvate metabolism
sphg01100  Metabolic pathways
sphg01110  Biosynthesis of secondary metabolites
sphg01120  Microbial metabolism in diverse environments
sphg01130  Biosynthesis of antibiotics
sphg01200  Carbon metabolism
Module
sphg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZE99_07915
   00020 Citrate cycle (TCA cycle)
    AZE99_07915
   00620 Pyruvate metabolism
    AZE99_07915
Enzymes [BR:sphg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZE99_07915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AMO71789
UniProt: A0A127MEW8
Position
complement(1656957..1658120)
Genome map
AA seq 387 aa AA seqDB search
MGIFTMPSLGADMEDGTLVEWLKAQGDTVTRGDIIAVVETEKGAIEIEIFEDGKIEEILV
PEGRKVPVGSPLATISGAGEAAVSEAVEPALPVAVEAPEAPEAALEIATIRPAIEDISEV
RASPAARLFAREHGIDLNGITGSGPSGAIQLRDVEAAKPAPAKRGIDLDAMRHAIAAAMS
RSKREIPHYYLTHRIDVNSAQNWLENYNLQRPAPERILFGALLVKAAALAIRDFPEFNGL
YEQDRFNTSQAVHAGVAIAIRGGGLAAPAIQNADQLSLAELMVQMRDLIGRVRRGSFRAS
ELTSSTMTVNSLGDRGVEGVLPIIYPPQVAIIGFGKIMELPWVVEGEIVARPIVQMTLAA
DHRVSDGHRGGLFLNAIAEKLDTPESL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcatattcaccatgccatcgctcggtgccgatatggaagacggtacgcttgtagaa
tggctgaaggcgcaaggcgacacagtgacccgcggcgatatcattgcggttgtcgaaacg
gaaaaaggcgcaattgaaatagagatattcgaagacggaaagatcgaggaaattctggtg
ccggagggccgcaaggtgccggtcggctcccctctggcgacaatatcgggagcaggcgaa
gcagcggtttccgaagctgtcgaaccagccttgccagttgcagtggaagcaccggaggca
ccagaagcggccctggagattgccacaattcgcccggctatcgaggatatctcggaagtc
cgcgcttcgcccgcggcgcggctatttgccagggaacatggaatcgacttgaacgggatc
actggcagcggaccgagtggtgccattcaactgcgcgatgtcgaagccgcgaaacctgcg
cccgcaaaacggggtatagatctggatgcaatgcgccacgccattgcagcggcaatgtcc
cgttcgaaacgggaaattccgcattattatctgacgcacaggatagacgtgaacagcgct
caaaactggctcgaaaactataatctgcagcgccctgccccggaacgcattttatttggc
gcgctactagtcaaggccgcggcgctcgcaatccgcgattttccggagtttaatgggctt
tatgaacaagacaggttcaacaccagtcaagcggttcatgccggcgtcgcgattgcaatc
cgtggcggcggccttgccgctccggcgattcagaatgccgatcagctttcattggcagaa
ttgatggttcagatgcgcgatttgatcgggagggtcaggcgcggcagctttcgtgcgtcc
gaactgacgagttcgaccatgaccgtgaacagtctcggtgatcgcggcgtggaaggcgtt
ctgccgatcatctatccgccgcaggtagcgataatcggatttggcaagatcatggaactg
ccatgggtggtcgagggtgaaattgttgcgcggccgatagttcagatgacattggcagca
gaccaccgggtgagcgacggtcatcgcggcggattgttcctgaacgccatagccgagaaa
cttgatacaccggagagcctatga

DBGET integrated database retrieval system