KEGG   Sphingorhabdus sp. M41: AZE99_10405Help
Entry
AZE99_10405       CDS       T04317                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00270  Cysteine and methionine metabolism
sphg00480  Glutathione metabolism
sphg01100  Metabolic pathways
Module
sphg_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZE99_10405
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZE99_10405
Enzymes [BR:sphg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AZE99_10405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMO72208
UniProt: A0A127MGD3
Position
complement(2179577..2180533)
Genome map
AA seq 318 aa AA seqDB search
MTLKIAVQMDPMETVNIAGDSSFALMLSAQKRGHQIFHYDVKGLTLQANGRLTTPAHPVT
VQPVKGDHFSFGDPVKLDLGSDVDVVLMRQDPPFHVGYITATHLLERIEGETLVVNNPVS
VRNAPEKVYVLDYAQFMPPTLITRDLDEVRAFQKEHGGVVVKPLHGNGGKAIFLVPEDGS
NLSALFEVFNQTWPEPHMVQPFLPEVHQGDKRIVLIDGEVAGAINRKPGEGEFRSNLAQG
GYAEAAELTEREQEICAAMGPDLKRLGLIFVGIDVIGGKWLTEINVTSPTGIVAIDNFNG
TDTPGMIWDAIERRLAAQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaaaatcgccgtacagatggacccgatggagaccgtgaatatagcgggagac
agcagcttcgcgctgatgctatccgcccagaaacgcgggcaccagatattccattatgac
gtgaagggcctgaccctgcaggccaatggccgcctgaccacgcccgcccatccggtgacg
gtgcagccggtcaagggcgaccatttcagcttcggcgatccggtaaaactcgacctcggc
agcgatgtcgatgtcgtgctgatgcgacaggacccgccgttccacgtcggctatatcacc
gcgacccatttgctcgaacggatcgagggcgagactctggtggtcaacaaccccgtctcc
gtccgcaacgcgccggaaaaagtctatgtgctcgactatgcccagttcatgccgccgacc
ctgatcacccgcgacctcgacgaagtccgcgccttccagaaggaacatggcggcgtcgtg
gtcaagccgctgcacggcaacggcggcaaggcgatctttctggtgccggaagacggcagc
aatctcagcgccctgttcgaggtattcaaccagacctggccggaaccgcatatggtccag
ccgttcctccccgaagtgcatcagggcgacaagcgcattgtgctgatcgatggcgaagtc
gccggcgcgatcaaccgcaagcccggcgaaggcgaattccgcagcaatcttgcacagggc
ggctatgccgaagcggcggaactgaccgagcgcgagcaggaaatctgcgccgcaatggga
cctgatctcaaacggcttggcctgatctttgtcggcatcgacgtgatcggcggcaaatgg
ctgaccgaaatcaacgtgacctcaccaaccggcatcgtcgccatcgacaatttcaacggc
accgacacgccgggcatgatctgggatgcgatcgagcggcggcttgccgcacaataa

DBGET integrated database retrieval system