KEGG   Sphingorhabdus sp. M41: AZE99_15790Help
Entry
AZE99_15790       CDS       T04317                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00071  Fatty acid degradation
sphg00072  Synthesis and degradation of ketone bodies
sphg00280  Valine, leucine and isoleucine degradation
sphg00310  Lysine degradation
sphg00362  Benzoate degradation
sphg00380  Tryptophan metabolism
sphg00620  Pyruvate metabolism
sphg00630  Glyoxylate and dicarboxylate metabolism
sphg00640  Propanoate metabolism
sphg00650  Butanoate metabolism
sphg00900  Terpenoid backbone biosynthesis
sphg01100  Metabolic pathways
sphg01110  Biosynthesis of secondary metabolites
sphg01120  Microbial metabolism in diverse environments
sphg01130  Biosynthesis of antibiotics
sphg01200  Carbon metabolism
sphg01212  Fatty acid metabolism
sphg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZE99_15790
   00630 Glyoxylate and dicarboxylate metabolism
    AZE99_15790
   00640 Propanoate metabolism
    AZE99_15790
   00650 Butanoate metabolism
    AZE99_15790
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZE99_15790
   00072 Synthesis and degradation of ketone bodies
    AZE99_15790
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZE99_15790
   00310 Lysine degradation
    AZE99_15790
   00380 Tryptophan metabolism
    AZE99_15790
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZE99_15790
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZE99_15790
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZE99_15790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphg04147]
    AZE99_15790
Enzymes [BR:sphg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZE99_15790
Exosome [BR:sphg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZE99_15790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5423
Motif
Other DBs
NCBI-ProteinID: AMO73117
UniProt: A0A127MIT2
Position
3318646..3319860
Genome map
AA seq 404 aa AA seqDB search
MTEAFIYDAVRSPRGKGRNDGALHEITALDLSAQVLASINDRNELEGHEVEDIAFGCVSP
VGEQGAVISRMAALKAGYADTTSAIQVNRFCGSGLEAVNIAAGKVCSGETDLAIGGGIES
MSRIPMGSDGLGGMADPTLVFQEYFVPQGISADLIATKYGYSRDDVDAYAVESQKRAARA
WDEKRFANSILPIRDVIGEVVLDRDELMRPETDMQSLGALGPAFKMMGEQMPGFNDVAIL
KHPEIEKINHVHHAGNSSGIVDGSAAVLVGNAGAAEKFGLKPRARIVSMAAIGSEPTIML
TGPEFAAKKALERAGMTANDIDLWELNEAFAAVVLRFMDAMNVDHSVMNVNGGAIAMGHP
LGATGAMILGTVLDELERTGKSTALATLCIGGGMGIATIIERVN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctttatctatgacgcagtgcgatcgccgcgcggcaagggccgcaacgat
ggtgccctgcatgaaatcaccgctctcgatctgtcggcacaggtgctggcatcgatcaac
gaccgcaacgaactcgagggccacgaagtcgaggatatcgcctttggctgcgtctctccc
gtcggcgagcagggcgcggtcatcagccgcatggcggcgctgaaagccggctatgcagac
acgacatcggcgatccaggtcaaccgcttctgcgggtccggtctggaagcggtgaacatc
gctgcgggcaaggtctgctccggcgaaaccgatctggcgattggcggcggcatcgaatcc
atgtcgcgcatcccgatgggcagcgacggcctcggcggcatggccgacccgaccctcgtc
tttcaggaatatttcgtgccgcagggcatttccgccgatctgatcgcgaccaaatatggc
tacagccgcgacgacgtcgacgcctatgccgtcgaaagccagaagcgcgccgccagagcc
tgggacgagaaacgcttcgccaattccatcctgccaatccgcgacgtgatcggtgaagtc
gtgctagatcgtgacgaactgatgcgccccgaaaccgacatgcagtcgctcggcgcgctc
ggccccgcgttcaagatgatgggcgaacagatgcccggcttcaacgatgtcgcgatcctc
aagcatcccgagatcgaaaagatcaaccatgtccaccatgccggtaacagttccggcatc
gtcgatggttcggcggcggtactcgtcggcaacgcaggcgctgccgaaaaattcggcctg
aaaccgcgagcgcggatcgtgtcgatggcggccatcggttccgaaccaacgatcatgctg
accggcccggaatttgccgcaaagaaggcactggaacgtgctggaatgacagcaaatgac
attgatctgtgggaattgaacgaagcttttgcagccgtggtattgcgcttcatggatgca
atgaatgtcgaccacagtgtaatgaacgtcaatggcggtgcgatcgccatgggccatccg
ctcggcgcgaccggcgcgatgatcctcggcacggtgcttgacgagctcgaacgtacgggc
aagtcgaccgccttggccactctgtgcatcggcggcggcatgggtatcgcgacgattatc
gaacgggtgaactaa

DBGET integrated database retrieval system