KEGG   Sphingomonas sp. WHSC-8: TS85_01085Help
Entry
TS85_01085        CDS       T03848                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00071  Fatty acid degradation
sphi00072  Synthesis and degradation of ketone bodies
sphi00280  Valine, leucine and isoleucine degradation
sphi00310  Lysine degradation
sphi00362  Benzoate degradation
sphi00380  Tryptophan metabolism
sphi00620  Pyruvate metabolism
sphi00630  Glyoxylate and dicarboxylate metabolism
sphi00640  Propanoate metabolism
sphi00650  Butanoate metabolism
sphi00900  Terpenoid backbone biosynthesis
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
sphi01120  Microbial metabolism in diverse environments
sphi01130  Biosynthesis of antibiotics
sphi01200  Carbon metabolism
sphi01212  Fatty acid metabolism
sphi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TS85_01085
   00630 Glyoxylate and dicarboxylate metabolism
    TS85_01085
   00640 Propanoate metabolism
    TS85_01085
   00650 Butanoate metabolism
    TS85_01085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TS85_01085
   00072 Synthesis and degradation of ketone bodies
    TS85_01085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TS85_01085
   00310 Lysine degradation
    TS85_01085
   00380 Tryptophan metabolism
    TS85_01085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TS85_01085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TS85_01085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TS85_01085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphi04147]
    TS85_01085
Enzymes [BR:sphi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TS85_01085
Exosome [BR:sphi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TS85_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJP70717
UniProt: A0A0C5KYS9
Position
230526..231677
Genome map
AA seq 383 aa AA seqDB search
MAEAYIVAAVRTAGGRRNGRLMGWHPVDLAGAVLSEVAARSGIDPAAIDDVIMGCVGQAG
EQALHVGRNAVLASTLPDSVPAVSIDRQCGSSQQAIQFAAQAVMSGTQDVVIAAGVEHMS
RVPMGTSVAGARPFSERVLARYGVKGFSQFTGAEMIARKYGQDRAMVDGYALESHRRAAA
AVERGDFADEILVLDVDTPDGAVRHAVDEGIRFDASLEGLGALKTLAEGGVVTAGNASQI
CDGASAVMVVSEAALKAHGLTPLARIVNLTVSAGDPVIMLEEPLFATDKALKRAGMSIGD
IDLYEVNEAFAPVPLAWLHHVGGDPARLNVNGGAIALGHPLGASGTKLMTTLVHALRKRG
LRYGLQTMCEGGGIANVTIVEAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcctatatcgtcgcggcggtgcgtaccgccggcgggcgtcgcaacgggcgg
ttgatggggtggcatcctgtcgatctggcgggggcggtgctgtccgaagtcgcggcgcgc
agcgggatcgatccggcggcgatcgacgatgtcatcatgggatgcgtggggcaggcgggc
gagcaggcgctgcatgtcgggcgcaacgcggtgctggcctcgactttgcccgacagcgtg
cccgccgtgtcgatcgaccggcaatgcggttcctcgcaacaggcgatccagttcgcggcg
caggcggtgatgtcgggcacgcaggacgtggtgatcgcagcaggcgtcgagcatatgagc
cgggtgccgatgggcacatccgtcgcgggcgcgcgaccgttcagcgagcgggtgctcgcg
cggtacggcgtgaaggggttcagccagttcactggtgccgagatgatcgcgcgcaaatat
ggccaggatcgcgcgatggtcgacggctatgcgctggagagccaccgccgcgccgccgcc
gcggttgagcgcggcgattttgccgacgagatattggtgctcgacgtcgatacgcccgac
ggggccgtgcgccacgctgtcgacgagggtatccgtttcgacgccagcctggaggggctg
ggcgcgctcaagacgctggccgagggcggggtggtgacggcgggcaatgccagccagatt
tgcgacggcgcgtcggcggtgatggtggtctccgaagccgcgctgaaggcgcatggcctc
acgccgctcgcccggatcgtgaacctgacggtgagcgcgggcgatccggtgatcatgctg
gaggagccgctgttcgcgaccgacaaggcgctcaagcgcgctggcatgtcgatcggcgat
atcgacctgtacgaagtcaacgaggcgttcgcgccggtaccgctcgcgtggctacaccat
gtcggcggcgatcctgcgcggctgaacgtcaatggcggggcgatcgcgctggggcatccg
ctgggtgcgagcgggaccaagctgatgacgacattggtccacgcgctgcgcaagcgcggg
cttcgctatgggttgcagacgatgtgcgaaggcggcggcattgccaacgtcaccatcgtc
gaagcgctttga

DBGET integrated database retrieval system