KEGG   Sphingomonas hengshuiensis: TS85_04160Help
Entry
TS85_04160        CDS       T03848                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sphi  Sphingomonas hengshuiensis
Pathway
sphi00460  Cyanoamino acid metabolism
sphi00500  Starch and sucrose metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TS85_04160
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    TS85_04160
Enzymes [BR:sphi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     TS85_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: AJP71180
UniProt: A0A0C5KSU6
Position
936525..938810
Genome map
AA seq 761 aa AA seqDB search
MKSLSLVTALLLAGGSVLVAPALIAQERPAPVSEKPWADKTLTPDRRAELLLAAMTLEEK
VALLHGPMAIPFGPQRPMPKGAVGSAGYIAGNERLGIPALQESDASLGVTNPGLVRGAAD
MSTALPASLLLAATFDPEIARAGGVLVGTEARAKGMNVQLAGGANLLRDPRGGRNFEYAG
EDPLLAGTIAGAAIRGIQSTGMVSTMKHFSINGQEHKRMTADSVIGEANHRESDLLAFQI
ALEAGDPGSVMCAYNLVNGVYACENDPLLNRTLKRDWGYKGWVMSDWGAVHSLGALTAGL
DQQSGEQLDKQVFFDKPLKDAVAAGSIPEARVTDAARRILRAMFANGLFDTPPAKAEIDF
PAHARIVQNQAEQGIVLLKNDSGVLPLARGAKKIAVIGQHVEAGVPSGSGSSQVTNPWRA
SPMTQVRSVPIGGEGMMASWSNVVFHPSSPLAAIRARFRSPGAADASPFAGPAPSPVVFN
NGIYPESAAADAKGADVAIVFVYQPSGEGDDVPNLTLPFGQDALVEAVAAANPNTIVVLQ
TGNAVALPWADKVKGIVQAWYSGGMGGEAIARVLFGEVNPSGRLPLTWPVDESQLPRPAI
PGWGEPADARVQVNYDIEGSDIGYRWFARENKVPRYWFGHGLSYTSFARSGLTLKGGQTV
TASVDVANTGKVAGSDVVQLYLVEKPGGPARRLLGYQKVALQPGETKRVTLNVDPRLLAE
YDEKAHGWRIDAGEYRIGVGADAGAVEGVTAVRLAARRIKP
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctctccctcgtgactgcccttttgctcgctggcgggtcggtgctcgtcgcg
cccgcgctgatcgcgcaggagcgcccggcgcccgtttcggaaaagccctgggcggacaag
accctgacgcccgatcgccgcgccgagctgttgctggcggcgatgacgttggaggagaag
gtggcgctgctccacggcccgatggcgatcccgttcgggccccagcgtccgatgccgaag
ggcgcggtgggatcggccggctatattgcgggcaacgagcgactgggcatccccgcgctg
caggaaagcgatgccagcctgggcgtgaccaatcccgggctggtgcgcggcgcggcggac
atgtcgacggcgctgcccgccagcctgttgctggccgcgaccttcgatccggagatcgcc
cgcgcgggcggggtgctcgtcggcaccgaggcgcgcgccaaggggatgaacgtccagctt
gcgggcggcgccaatctgctgcgcgatccgcgcggcgggcgcaatttcgagtatgccggc
gaagacccgttgctcgcgggcacgatcgcaggcgcggcgatccgcggcattcagtcgacc
ggcatggtctcgacgatgaagcatttctcgatcaacggtcaggagcataagcgcatgacc
gcggattcggtgatcggcgaggccaatcatcgcgaaagcgacctgctcgccttccagatc
gcgctggaggcgggcgatcccggatcggtgatgtgcgcgtacaacctcgtcaacggcgtc
tatgcctgcgagaacgacccgctgctcaaccgcacgctgaagcgcgactggggctataag
ggctgggtgatgtccgattggggcgccgtgcattcgctgggcgcgctcaccgcggggctc
gaccagcaatcgggcgagcagctcgacaagcaggtgttcttcgacaagccgctgaaagac
gccgtcgccgccgggtcgatccccgaggcgcgcgtcaccgatgccgcccggcgcatcctg
cgcgcgatgttcgccaacggcctgttcgacacgccccccgcaaaggccgaaatcgatttc
cccgcgcacgcccggatcgtccagaaccaggcggagcagggcatcgtgctgctcaagaac
gacagcggcgtgctgccgctggcgcgcggcgcgaagaaaatcgcggtgatcggccagcat
gtcgaggcaggcgtgccctcgggcagcggatcgtcgcaagtcaccaacccgtggcgcgcg
agcccgatgacgcaggtgcgcagcgtcccgatcgggggcgaggggatgatggcgtcgtgg
tccaacgtcgtcttccacccctcatcgccgctcgccgcgatccgtgcgcggttccgcagc
ccgggggcagcggacgcttcaccgttcgcggggcccgcgccgtcgccggtggtgttcaac
aacggcatctatcctgaatccgccgccgccgatgccaagggcgccgatgttgcgatcgtg
ttcgtctatcaaccctcgggcgagggcgatgacgtgccgaacctcacgctgcccttcggc
caggacgcgctggtcgaggcagtggccgcggccaatcccaacaccatcgtcgtgctccag
accggcaatgccgtggcgttgccctgggcggacaaggtgaaggggatcgtccaggcctgg
tattcgggcggcatgggcggcgaggcgatcgcgcgggtgttgttcggcgaagtcaatccg
tcgggcaggctgccgctgacctggcccgtcgacgaaagccagctgccgcgcccggccatc
cccggctggggcgagcccgccgatgcccgggtgcaggtgaactacgatatcgagggttcg
gacatcggctatcgctggttcgcgcgcgagaacaaggtgccgcgctattggttcggccat
gggctgagctacaccagcttcgcccgatcgggcctgacgctgaagggcggccagacggtg
accgccagcgtcgacgtcgccaataccggcaaggtcgcgggcagcgacgtggtccagctc
tatctggtcgaaaagcccggcggtccggcgcgccggctgctgggctatcagaaggtcgcg
ttgcagcccggcgagaccaagcgggtgacattgaacgtcgatccgcggctcctcgccgaa
tatgacgagaaggcgcatggctggcgcatcgatgcgggcgagtatcggatcggcgtcggc
gcggatgccggcgcggtcgagggcgtgaccgcagtgcggctcgccgcgcggcgcatcaag
ccctga

DBGET integrated database retrieval system