KEGG   Sphingomonas hengshuiensis: TS85_06260Help
Entry
TS85_06260        CDS       T03848                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sphi  Sphingomonas hengshuiensis
Pathway
sphi00620  Pyruvate metabolism
sphi00630  Glyoxylate and dicarboxylate metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
sphi01120  Microbial metabolism in diverse environments
sphi01200  Carbon metabolism
Module
sphi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TS85_06260
   00630 Glyoxylate and dicarboxylate metabolism
    TS85_06260
Enzymes [BR:sphi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TS85_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AJP71459
UniProt: A0A0C5LED8
Position
1425501..1427606
Genome map
AA seq 701 aa AA seqDB search
MSAFVDRAGLKIAGPLARFVEERVLPGLDIAAEGFWRGTAEIFARFTPENRALLARRDAL
QAQIDLWCAEEPARAADPTAQEAFLRSIGYLVDTPAPFTIHTGAVDPEIAQLAGPQLVVP
GLNARFLLNAANARWGSLYDALYGTDALPGAPRPGGYDRERGAQVIARAKAFLDEAVPLA
DMAWAEFTQGDLPLADPTQFVGQRGESLLFRHHGLHIEVVIDRTHPIGAIDPAGIADVVL
EAALTAIVDLEDSVAAVDAEDKVAAYANWLGLMRGDLEERFDKGGVAITRRLAEDRVYQV
PGAGDLTLSGRSLLFVRNVGHLMTTPALLLPDGGEAPEGILDAIVTSLIALHDLRGLGSH
RNSRAGSVYIVKPKMHGPEECAFTDRLFDAVEDLLGLARHMIKVGVMDEERRTSANLAAC
IDAVKHRIVFINTGFLDRTGDEMHTSMHAGPMVPKGEMKALPWIAAYEDRNVRIGLACGF
SGRAQIGKGMWAAPDRMADMLAQKGAHPLSGANTAWVPSPTAATLHALHYHQVDVFARQR
EIAGESIPALAPLLTIPVAIGRNWSRDEIEQELDNNAQGILGYVVRWIDQGIGCSKVPDI
HDVGLMEDRATLRISSQLLANWLFHGVASAVDVEAALERMALKVDAQNRGDPLYRSLAGA
EGQAGLAFQAARALVFEGAAQPNGYTEPLLHRFRREAKARG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttttgtcgatcgcgccgggctgaaaattgccggaccactcgcccgcttcgtc
gaggagcgcgtgctgcccggactggacatcgcagccgaagggttttggcgcgggactgcc
gagatattcgcccgcttcacgcccgagaaccgcgcgctgctggcccgccgtgatgcgcta
caggcgcagatcgacctttggtgcgcagaagagccggcgcgcgctgcggacccgaccgcg
caggaggcctttctgcgaagcatcggctatctggtcgacaccccggcaccgttcacgatc
cataccggtgccgtcgatcccgagattgcccagcttgccgggccgcagctcgtcgtgccg
gggctcaacgcgcgcttcctgctcaacgccgccaatgcgcgctggggcagcctgtatgat
gccttgtacgggaccgacgcgcttccgggcgcaccccggcccgggggctatgatcgcgaa
cgcggcgcgcaggtgatcgcgcgggcaaaagcgtttctggacgaagccgttccgctggcc
gatatggcctgggccgagttcacacagggcgatttgccgctggcagatccgacgcagttt
gtagggcagcggggcgaatcgttgctgtttcgccaccacgggctgcacatcgaagtggtg
atcgatcgcacccacccgattggcgcgatcgatcctgcgggcattgcggatgttgtgctc
gaagcggcgctgacggcgatcgtcgatctggaggattcggtcgccgcggtcgatgccgag
gacaaggtcgcggcctatgccaattggcttgggttgatgcgcggcgatctggaggagcgt
ttcgacaagggcggcgtggcgatcacccggcggcttgcggaggaccgcgtctatcaggtt
ccgggggcgggcgacctgacgctgtccgggcgttcgttgctgttcgtccgcaacgtcggc
catctgatgaccacccccgcgctgctgctgcccgatggaggcgaggcgccggagggcata
ttggacgcgatcgtcaccagcctgatcgcgctccacgacctgcgcgggctcggcagccac
aggaacagccgcgccggatcggtctatatcgtcaagcccaagatgcacggtccggaggaa
tgcgcgttcaccgatcggctgttcgatgcggtcgaggacctgctcgggctggcgcggcac
atgatcaaggtcggcgtgatggacgaggagcgccgcacctcggccaatctcgcggcgtgc
atcgacgcggtgaagcaccgtatcgtcttcatcaacaccggctttctcgatcgcaccggc
gatgagatgcacaccagcatgcacgccgggccgatggtgccgaagggcgagatgaaggcg
ctgccgtggatcgccgcctatgaggatcgcaacgttcgcatcgggctggcctgcggcttt
tcgggcagggcgcagatcggcaaggggatgtgggcggcgcccgaccggatggccgatatg
ctcgcgcagaagggtgcgcatccgctgtcgggggcgaacaccgcatgggtgccgtcgccg
accgccgcgacgctgcatgcgcttcactatcatcaggtcgatgtgttcgcccggcagcgc
gagatcgctggcgagagcatcccggcgctggcgccgctactgacgattcccgtcgcgatc
gggcgcaactggagcagggacgagatcgagcaggaactcgacaataatgcgcagggcatt
ctcggctatgtagtgcgttggatcgatcagggtatcggctgctccaaggtgcccgacatc
catgacgtcgggttgatggaggaccgcgcgacgctgcgcatttcgtctcagcttctcgcc
aactggctgtttcacggggttgcgagcgcggtcgatgtcgaagccgcgctggagcgcatg
gccttgaaagtcgatgcgcagaaccgcggcgacccgctgtacagatcgcttgcgggggcc
gaagggcaggccgggctggcgtttcaggcagcgcgcgcgctcgtgttcgaaggggctgcg
caacctaatggctataccgagcccttgctgcaccgcttccggcgtgaggcaaaggcgcgg
ggctga

DBGET integrated database retrieval system