KEGG   Sphingomonas hengshuiensis: TS85_09040Help
Entry
TS85_09040        CDS       T03848                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sphi  Sphingomonas hengshuiensis
Pathway
sphi00010  Glycolysis / Gluconeogenesis
sphi00071  Fatty acid degradation
sphi00350  Tyrosine metabolism
sphi00625  Chloroalkane and chloroalkene degradation
sphi00626  Naphthalene degradation
sphi00680  Methane metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
sphi01120  Microbial metabolism in diverse environments
sphi01130  Biosynthesis of antibiotics
sphi01200  Carbon metabolism
sphi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TS85_09040
  09102 Energy metabolism
   00680 Methane metabolism
    TS85_09040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TS85_09040
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TS85_09040
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TS85_09040
   00626 Naphthalene degradation
    TS85_09040
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TS85_09040
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     TS85_09040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJP71901
UniProt: A0A0C5L3Y9
Position
complement(2058620..2059702)
Genome map
AA seq 360 aa AA seqDB search
MKAAILFAPGTPLEIRDVDVAAPGPREVLIRTAAVGVCRSDLHFVDGAFPHPVPTVPGHE
AAGIVEAVGSDVAHLKPGDHVITFFTVFCGSCEMCVSGRPSLCIDPSTRRPPDAPPRLSL
DGAPLAPFLNLSALAEKMLVHENACVAIDKAMPLDRAALLGCAVITGAGAVFNDSRVRPG
ESVAVIGAGGIGLSAINAAKIAGAGQILAIDPMPEKRDLATKLGATHALDPSAPTIVKDV
LKRTGGGVHYAIEAVGRSDTAELAWNILRRGGTATILGMIAPGNNVTLPGPTFLTGKKIQ
GSLLGSTRFPIDMPRLVRMYLDGLLDLDTMVAERIALEDVNDALQKLRDGHSVRSVIVFA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcaatcctcttcgcccccggcaccccgctcgaaatccgcgatgtcgatgtc
gccgcccccggcccgcgcgaagtgctgatccgcaccgccgcggtcggggtctgccgctcc
gacctccatttcgtcgacggcgccttcccgcacccggtgcccaccgtccccggccacgaa
gccgccggcatcgtcgaggcggtcggcagcgacgtcgcgcatctaaagcccggcgatcat
gtcatcaccttcttcaccgtcttctgcggatcgtgcgagatgtgcgtcagcgggcgcccg
tcgctgtgcatcgatccgtccacccgccgcccgcccgacgcgccgccgcgcctcagcctc
gacggcgccccgctcgcgcccttcctcaatctctcggcccttgccgagaagatgctggtc
cacgaaaacgcctgtgtcgcgatcgacaaggcgatgccgctcgatcgcgccgccttgctc
ggctgcgcggtcatcaccggggcgggggcggtgttcaacgacagccgcgtgcgcccgggc
gaaagcgtcgcggtgattggcgcgggcgggatcggcctgtccgcgatcaacgccgcgaag
atcgccggcgccgggcagatcctcgcaatcgacccgatgcccgaaaagcgcgacctcgcg
acgaagctgggcgccacccacgcgctcgatccgtccgcaccgacaatcgtcaaggacgtg
ctcaagcgcaccggcggcggtgtccattatgcgatcgaggcagtcgggcgctccgacacc
gccgaactcgcctggaacatcctgcgccgcggcggcactgcgacgatcctcggcatgatc
gcccccggcaacaatgtcactttgccggggccgaccttcctgacgggcaagaagatccag
ggctcgctgctcggcagcacgcgcttcccgatcgacatgccccggctggtgcgaatgtat
ctcgacgggctgctcgatctcgacacgatggtcgccgagcgtatcgcgctcgaggacgtc
aatgatgcgctgcaaaagctccgcgacgggcacagcgtccgttcggtgatcgtcttcgca
tga

DBGET integrated database retrieval system