KEGG   Sphingomonas sp. WHSC-8: TS85_12360Help
Entry
TS85_12360        CDS       T03848                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00360  Phenylalanine metabolism
sphi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphi00790  Folate biosynthesis
sphi01100  Metabolic pathways
sphi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TS85_12360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TS85_12360
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TS85_12360
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     TS85_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AJP72409
UniProt: A0A0C5LGS3
Position
complement(2800936..2801805)
Genome map
AA seq 289 aa AA seqDB search
MENPDILPPAGAAPDWTIPQDWARYTPDEHAMWDRLFARQAKMLPGRAAPEYLEGLEMLR
MSRPGIPNFDELSERLMQATGWQVVAVPGLVPEAVFFDHLANRRFVAGRFIRTPDQLDYL
EEPDIFHDVFGHVPLLANPVFADYMQAYGQGGQRAAGLGAIDNLARLYWYTVEFGLIRSD
AGLRIYGAGIVSSYGESVFALDDPSPNRLGFDLQRLMRTKYRIDDYQQNYFVIDSFDQLL
RQTLDTDFGPLYDKIQALPEIEIETILPSDTVYTSGTQAYARAKEAQAI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccccgatatccttccccctgccggggccgcaccagactggacgattccgcag
gactgggcgcgctacaccccggacgaacacgcgatgtgggaccggctgttcgcgcgtcag
gccaagatgctccccggtcgcgccgcgcccgaatatctcgaggggctcgagatgctgcgc
atgtcgcgcccgggcatccccaatttcgacgaactgtccgaacggctgatgcaggcgacc
ggctggcaagtcgtggcggtgcctgggttggtgcctgaggcggtgttcttcgatcacctc
gccaatcgccgcttcgtcgcggggcgcttcatccgcacgcccgaccagctcgattatctg
gaggagcccgatatcttccacgacgtgttcggccatgttccgctgctcgcgaacccggta
ttcgccgactatatgcaggcctatggccagggcggacagcgcgcggcggggctgggcgcg
atcgacaatctggcgcggctctattggtacaccgtcgaattcgggctgatccgcagcgat
gcgggcctgcgcatctatggcgcggggatcgtgtcctcctatggcgagtcggtgttcgcg
ctcgacgacccctcgcccaaccggctgggcttcgacctacagcggctgatgcgcaccaaa
taccggatcgacgattaccagcagaactacttcgtgatcgacagcttcgaccaactgctc
cgccagacgctcgataccgatttcggaccgctctacgacaaaatccaggcgctgcccgag
atcgagatcgagacgatcctgcccagcgacaccgtctatacaagcggcacccaggcgtac
gcgcgggccaaggaggcgcaggcgatctga

DBGET integrated database retrieval system