KEGG   Sphingomonas sp. WHSC-8: TS85_19955Help
Entry
TS85_19955        CDS       T03848                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00020  Citrate cycle (TCA cycle)
sphi00640  Propanoate metabolism
sphi00660  C5-Branched dibasic acid metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
sphi01120  Microbial metabolism in diverse environments
sphi01130  Biosynthesis of antibiotics
sphi01200  Carbon metabolism
Module
sphi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sphi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TS85_19955 (sucC)
   00640 Propanoate metabolism
    TS85_19955 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TS85_19955 (sucC)
Enzymes [BR:sphi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TS85_19955 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJP73583
UniProt: A0A0C5L8N1
Position
complement(4388666..4389865)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKFGVPVPAGFAAMSVEEAVEASKKLPGQLYVVKAQIHAGGRGKGKFK
ELSPEAKGGVRLAKTEEEVRAAAADMLGNTLVTIQTGDAGKQVNRLYVTDGVDIAKEFYL
ALLVNRASGRIGMVVSTEGGMDIETVAHDTPEKIHTIDIDPATGFMPHHGRAVANALGLS
GDLAKQAASTASKLYDAFLGTDAAQIEINPLAVTEDGKLMVLDAKVGFDSNALFRHPDLM
ELRDETEEDPAELEASKYDLAYIKLDGDIGCMVNGAGLAMATMDIIKLNGMFPANFLDVG
GGATKEKVTAAFKIILSDPAVKGILVNIFGGIMRCDIIAEGIVAAAKEVNLSVPLVVRLE
GTNVEKGKEILATSGLAIVPANDLGDAAQKIVAEVKKVA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaggccaaggaattgctggcgaagttcggcgtgcccgtcccc
gccggctttgctgcgatgagcgtcgaggaggccgtcgaggcttcgaagaagctccccggg
cagctttatgtcgtcaaggcgcagattcatgccggtggccgtggcaagggcaagttcaag
gagctgtcgcccgaggccaagggcggcgtccgcctcgccaagaccgaggaagaggttcgc
gccgccgctgccgacatgctcggcaacacgctggtgacgatccagaccggcgacgccggc
aagcaggtcaaccgcctctacgtcaccgacggcgtcgacatcgccaaggaattctacctc
gcgctgctcgtcaatcgtgcgtcgggccggatcggcatggtcgtctcgaccgaaggcggg
atggacatcgaaaccgtcgcgcacgacacgccggaaaagatccacacgatcgacatcgac
cctgcgaccggcttcatgccgcaccatggccgcgccgtcgccaacgcgctgggcctgagc
ggcgacctcgccaagcaggcggcgtcgacggcgtcgaagctgtatgatgcgttcctcggc
accgacgccgcgcagatcgagatcaatccgctggcggtcaccgaggacggcaagctgatg
gtgctcgacgccaaggtcggcttcgattcgaacgcgctgttccgccaccccgacctgatg
gaactgcgcgacgagaccgaggaagacccggccgagctggaagcgtccaagtacgacctg
gcctatatcaagctcgacggcgacatcggctgcatggtcaacggcgccggcctcgcaatg
gcgacgatggacatcatcaagctcaacggcatgttcccggcgaacttcctcgacgtcggc
ggcggcgcgaccaaggaaaaggtcacggcggcgttcaagatcatcctgagcgatccggcg
gtaaagggcatcctcgtcaacatcttcggcgggatcatgcgctgcgacatcatcgccgag
ggcatcgtcgccgcggccaaggaagtgaacctttcggtgccgctggtcgttcgcctcgaa
gggacgaacgtcgagaagggcaaggaaatcctcgccacttcggggctggcgatcgttccc
gccaacgacctgggcgacgccgcgcagaagatcgtggcggaagtgaagaaggtcgcgtga

DBGET integrated database retrieval system