KEGG   Sphingomonas sp. JJ-A5: BSL82_00445Help
Entry
BSL82_00445       CDS       T04967                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
sphj  Sphingomonas sp. JJ-A5
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSL82_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: API57959
UniProt: A0A1L3ZQQ6
Position
85687..86085
Genome map
AA seq 132 aa AA seqDB search
MKALFPHAATTRGVTVRVVVSYLADQSQPTDGRWFWAYHVRIENEGEGQVQLLSRHWLIR
DGNGVLHEVKGDGVIGEQPVIEPGGAYDYVSACPLGTRNGSMEGSYQMVAEDGGTFDAVI
PRFELTVPAVTT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcgctgttccctcatgccgccaccacgcgcggcgtgacggttcgcgtcgtcgtg
agctaccttgccgatcagagccagccgacggacgggcgctggttctgggcctatcatgtg
cggatcgaaaacgaaggggagggacaggtccagctcctttcgcgccattggctgatccgc
gacggcaacggcgtactgcacgaggtgaagggcgatggcgtgatcggcgagcagccggtg
atcgaacccggcggcgcttatgattatgtgtccgcctgcccgctcggtacccgcaacggg
tcgatggaaggcagctatcagatggtggcggaagacggcggcacgttcgacgcagtgatc
ccccgcttcgagctgaccgttccggcggtgacgacatga

DBGET integrated database retrieval system