KEGG   Sphingomonas sp. JJ-A5: BSL82_05530Help
Entry
BSL82_05530       CDS       T04967                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00564  Glycerophospholipid metabolism
sphj01100  Metabolic pathways
sphj01110  Biosynthesis of secondary metabolites
Module
sphj_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSL82_05530
Enzymes [BR:sphj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BSL82_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: API58833
UniProt: A0A1L3ZT69
Position
complement(1079535..1080266)
Genome map
AA seq 243 aa AA seqDB search
MASIKSAPGTTVKYRMPSVHPEGVKFVVIAAVICAALAFFGWETLAWPMAGITLWVAAFF
RDPVRATPSGEGVIASPADGLVTMIQEVTPPHELTSGEGGLEPEPVIRVSIFMSVFDVHI
NRAPVGGRVSRVVYVPGKFLNADLDKASDDNERQYFVVERPDGVKVGFTQIAGLVARRIV
KFAKVGDIVVAGQRIGLIRFGSRVDVFLPSGTAPKVVLGQRAIAGETVLGIIGDFVPAAG
VLQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcatctatcaaaagcgcaccgggcacgaccgtgaaataccgcatgccttcggttcat
cccgaaggcgtcaagttcgtggtgattgcggccgtcatctgcgccgccctcgcctttttt
ggatgggagacgctcgcctggccgatggccggcatcaccctgtgggtggccgcgtttttc
cgcgaccccgtcagggcgacgccttccggcgagggcgtgatcgcttctcccgccgatgga
ctggtgacgatgatccaggaggtcacgccgccccatgaactgacgagcggggagggcggg
ctggagccggaacccgtcatccgcgtttccatcttcatgagcgtgttcgacgtccacatc
aatcgcgcgcccgtgggcgggcgggtgtcccgcgtggtgtacgtgccgggcaagttcctg
aacgccgatctggacaaggcgagcgacgacaatgagcggcagtatttcgtcgtcgagcgg
cctgacggcgtgaaggtcggcttcacccagattgcggggctggtcgcccggcgcatcgtc
aaattcgccaaggtgggcgatatcgtggtggccgggcagcggatcggccttatccgcttc
gggagcagggtggacgtgttcctgccgagcggcacagcccccaaggtggtgctcgggcag
cgtgcgatcgcgggcgagaccgttctgggcataattggcgatttcgtgcctgccgccggc
gtgctgcagtga

DBGET integrated database retrieval system