KEGG   Sphingomonas sp. JJ-A5: BSL82_06620Help
Entry
BSL82_06620       CDS       T04967                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00480  Glutathione metabolism
sphj00590  Arachidonic acid metabolism
sphj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BSL82_06620
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSL82_06620
Enzymes [BR:sphj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BSL82_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: API59024
UniProt: A0A1L3ZTR2
Position
complement(1278796..1279344)
Genome map
AA seq 182 aa AA seqDB search
MASVIQDIPLKTIDGRPASLGDYRGSVLLVVNVASKCGLTPQYEALQALYSRYKGQGLVV
VGFPANDFAGQEPGTNEEISSFCSTNYGVDFPMFSKLVATGEGRHPLYSALIEAQPKATP
ADEDMREKLKGYGITPTPEPEVLWNFEKFLVGRNGNVVARFAPNMAPDDPRIVSAIEAEL
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggtgattcaggacattccgttaaaaacaatcgacggtcgaccggcttctctt
ggcgattatcgagggtcggtcctgctggtcgtgaacgtcgcctccaaatgcgggctcacg
ccgcaatatgaggcgttgcaggcgctttattcgcgctacaagggccaggggcttgtggtc
gtcggtttccccgcgaatgatttcgccgggcaggagccgggcaccaacgaagagatatcg
agcttttgctccaccaattatggcgtcgattttccgatgttttcaaagctggtggccacg
ggtgagggtcgccacccgctctattcggcgttgatcgaggcgcagcccaaggcgactccg
gccgacgaggacatgcgcgaaaagctcaaaggctatggcataacgccgacgccggaaccg
gaagtgctctggaacttcgagaagttcctggtcggccggaacggcaatgtcgtcgcgcgc
ttcgccccaaacatggcgcccgacgatccgcgcatcgtctcggcgatcgaagccgaactg
gcgaaataa

DBGET integrated database retrieval system