KEGG   Sphingomonas sp. JJ-A5: BSL82_10330Help
Entry
BSL82_10330       CDS       T04967                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00360  Phenylalanine metabolism
sphj00362  Benzoate degradation
sphj00621  Dioxin degradation
sphj00622  Xylene degradation
sphj01100  Metabolic pathways
sphj01120  Microbial metabolism in diverse environments
sphj01220  Degradation of aromatic compounds
Module
sphj_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
sphj_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BSL82_10330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSL82_10330
   00622 Xylene degradation
    BSL82_10330
   00621 Dioxin degradation
    BSL82_10330
Enzymes [BR:sphj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BSL82_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: API59666
UniProt: A0A1L3ZVI2
Position
1972161..1973189
Genome map
AA seq 342 aa AA seqDB search
MSFDPTTTKLYIQDVTLRDGMHAIRHQYGLDHVQAIAKALDRAKVDAIEVAHGDGLSGSS
FNYGFGAHTDWDWIGAVAEVLEHSVLTTLLLPGIGTIHDLKHAYELGVRSVRVATHCTEA
DVARQHIEYARGLGMDVSGFLMMSHMSAPDALAQQARLMESYGAHCVYVTDSGGAMSMDD
CAARLAAYDRVLKPETQRGVHAHHNLSLGVANSIVAVQGGAVRVDASLAGMGAGAGNAPL
EVFIAAADRMGWNHGTDLYALMDAAEELVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAE
KASAEYGVDTRAILVELGKRKMVGGQEDMIVDVALDMARRES
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgatccgaccaccaccaagctctatatccaggatgtcaccttacgcgacggg
atgcacgccatccgccaccaatatggtctggatcatgtgcaggcgatcgccaaggcacta
gaccgcgcgaaagtcgatgcaatcgaagtcgcgcatggagacgggctatcaggatcttcg
ttcaattacggcttcggtgcccataccgactgggactggatcggcgcggtggccgaagta
ctcgaacattctgtcctcaccacactgctgctgcccggcatcggcacgatccacgatctc
aagcacgcctatgagctgggtgtgcgctctgtccgggtcgcgacccactgcaccgaggcc
gatgtcgccaggcaacatatcgaatacgcgcgcgggcttggcatggacgtgtcaggcttc
ctgatgatgagccacatgtccgcgcccgatgcgctggcgcagcaggccaggctgatggaa
agctacggcgcgcattgcgtttatgtcaccgacagcggcggcgccatgtcgatggacgat
tgcgccgcccggcttgcggcctatgaccgggtgctgaagcccgaaacgcagcgcggcgtg
cacgcgcaccacaacctgtcgctgggcgtcgccaattccatcgtcgcggtgcagggcggc
gcggtgcgcgtcgatgcgtcgctggcaggcatgggcgcgggcgcgggcaatgcgccgctg
gaggtgttcatcgcggcggcggaccggatgggctggaatcacggcaccgatctctatgcg
ctgatggatgcggccgaagagctggtgcgtccgttgcaggaccgcccggtgcgggtggac
cgcgagacgctgacgctgggctatgccggcgtctattccagctttctgcgccatgccgag
aaagccagcgcggaatatggcgtcgatacccgcgcaatcctggtcgaactcggcaagcgc
aagatggttggcggacaggaggacatgatcgtcgatgtcgcgctcgatatggcccgacgg
gaaagctga

DBGET integrated database retrieval system