KEGG   Sphingomonas sp. JJ-A5: BSL82_10675Help
Entry
BSL82_10675       CDS       T04967                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00071  Fatty acid degradation
sphj00072  Synthesis and degradation of ketone bodies
sphj00280  Valine, leucine and isoleucine degradation
sphj00310  Lysine degradation
sphj00362  Benzoate degradation
sphj00380  Tryptophan metabolism
sphj00620  Pyruvate metabolism
sphj00630  Glyoxylate and dicarboxylate metabolism
sphj00640  Propanoate metabolism
sphj00650  Butanoate metabolism
sphj00900  Terpenoid backbone biosynthesis
sphj01100  Metabolic pathways
sphj01110  Biosynthesis of secondary metabolites
sphj01120  Microbial metabolism in diverse environments
sphj01130  Biosynthesis of antibiotics
sphj01200  Carbon metabolism
sphj01212  Fatty acid metabolism
sphj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSL82_10675
   00630 Glyoxylate and dicarboxylate metabolism
    BSL82_10675
   00640 Propanoate metabolism
    BSL82_10675
   00650 Butanoate metabolism
    BSL82_10675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSL82_10675
   00072 Synthesis and degradation of ketone bodies
    BSL82_10675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSL82_10675
   00310 Lysine degradation
    BSL82_10675
   00380 Tryptophan metabolism
    BSL82_10675
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSL82_10675
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSL82_10675
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSL82_10675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphj04147]
    BSL82_10675
Enzymes [BR:sphj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSL82_10675
Exosome [BR:sphj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSL82_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: API59725
UniProt: A0A1L3ZVU1
Position
complement(2038220..2039404)
Genome map
AA seq 394 aa AA seqDB search
MSSDPVVIVSYARTPMGGFQGALSSCRATELGSAAVKAALSRAGVSGEAVEQIVMGCVLA
AGLGQAPARQAGLGAGLPLSAEAVTVNKMCGSGMQAAIMAHDALAAGSAALIVAGGMESM
TNAPYALPKHRSGARIGHDRVIDTMMMDGLEDAYTPGKAMGAFAEDAAREYQFTREQQDA
YALESLARAQKAIGTGAFEREVVSIEVKTRKGLETVSIDEQPGKAQPEKIPTLKPAFVKD
GTITAANASSISDGAAALVMTRASVAEKLGLSPVARVVAHAAHAHEPGLFTTAPVPAMKK
LLAKAGWTVGDVDLFEVNEAFAVVAMIAMQELSIPHDKLNVNGGATALGHPIGASGARIL
ATLLAALQNRGLKKGVASLCIGGGEATAMAVELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgatcctgttgtcattgtgtcttatgcccgcacgccgatgggcggctttcaa
ggggcgctgtcgtcatgcagggccaccgagcttggctcggcggcggttaaggcggcgctg
tcgcgcgccggcgtctccggagaggctgtcgagcagatcgtgatggggtgcgtgcttgcc
gcagggctcggacaggcgccggcccggcaggcgggtctgggggcgggcctgccgctgtcg
gcggaggccgtgaccgtcaacaagatgtgcggctcgggcatgcaggccgccatcatggcg
catgatgcgctcgccgccggcagcgccgccctgatcgtggcaggcggcatggagtcgatg
acgaacgcgccttatgcgctgccgaagcatcgctcgggcgcgcgcatcggccatgaccgc
gtcatcgacacgatgatgatggacgggctcgaggacgcctacacgccagggaaagccatg
ggcgcctttgccgaggacgcggcgcgcgaataccagtttacccgcgagcagcaggacgcc
tatgcgctggagtcgcttgcgcgcgcgcagaaggcgatcgggacgggtgcgttcgagcgc
gaggtagtgagcatcgaggtgaagacccggaagggcctggagaccgtctccatcgacgag
cagccgggaaaggcgcagcccgagaagatcccgacgctcaaaccagccttcgtcaaggac
ggcacgatcacagcggccaacgcctcctcgatctcggacggtgcggcggcactcgtcatg
acccgggcaagcgtcgccgagaagctgggcctctcgcctgtggcgcgcgtggtggcgcat
gccgcccacgcgcatgagccggggctgttcacgacagcgcccgtgccggcgatgaagaag
ctgctggcaaaggccggctggaccgtgggcgacgtcgacctgttcgaggtgaacgaagcc
ttcgcggtcgtcgcgatgatcgcgatgcaagagctgagcatcccgcacgacaagctcaac
gtcaacggcggagcaacagcgctcggccacccgatcggggcgtcgggcgcccgcatcctc
gcgacgttgctggcggctctccagaaccgtgggctgaagaagggcgtggcgtcgctgtgc
atcggcggcggcgaggccaccgccatggcggtcgagctcatctga

DBGET integrated database retrieval system