KEGG   Tardibacter chloracetimidivorans: BSL82_13970
Entry
BSL82_13970       CDS       T04967                                 

Definition
(GenBank) hypothetical protein
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
sphj  Tardibacter chloracetimidivorans
Pathway
sphj00626  Naphthalene degradation
sphj01100  Metabolic pathways
sphj01120  Microbial metabolism in diverse environments
sphj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    BSL82_13970
Enzymes [BR:sphj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     BSL82_13970
SSDB
Motif
Pfam: DHDPS Abhydrolase_6
Other DBs
NCBI-ProteinID: API60260
UniProt: A0A1L3ZXC3
Position
complement(2707012..2708007)
AA seq 331 aa
MQAQDFKGLYAIIPTPSRAGAQAIDATDTVALDETERLIHALIDDGANGLIVLGTTGECA
TISNEDYRSFVATVAETVGKRIPLFVGATAMGGHEAYKRLAFARDRGADGTLLGLPMWQP
CTVDMAVRFYAEVGQAFPDLAVMVYANARAFRFSFPTDFWARIAKEAPTVTSAKSSQPTN
LAENIAATGGRIHFMPSDMVVAKFHAISPATTTSCWATAAGMGPEPSRALIDAIMAGDTD
RARHIDERIAWSIAPLAPMLGNPELFASYNTQMEKTRMAEANYCDPGPVRPPYDVFPGDY
AEAAREAGRRWRLLREEFAGERAAAATKAVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcaggcacaggatttcaagggactttacgcgatcattccgacgccgtcgcgtgcaggc
gcgcaggcgatcgacgccaccgacaccgtggcgctcgacgagaccgagcgacttattcac
gcgctgatcgacgatggggccaacggcctgattgtcctgggtaccaccggcgaatgtgcg
accatctcgaacgaggattatcgcagcttcgtcgcgacggtcgccgagaccgtaggcaag
cgcattccgcttttcgtcggcgcgaccgcgatgggcggccacgaagcctacaagcggctc
gccttcgcgcgcgaccggggcgccgacggaacgctgctcggcctgccgatgtggcaaccc
tgcaccgtcgatatggccgtgcgcttctatgccgaggtcggacaggcattccccgatctg
gcagtgatggtctacgcaaatgcgcgcgccttccgcttctcctttcccaccgatttctgg
gcgcggatcgcgaaggaggcgccgacggtgacgtcggccaaatcatcccagcccactaat
ctcgcggagaatatcgccgcgaccggggggcggattcatttcatgccgagcgacatggtc
gtggccaagttccatgcgatctcgccggcaacaaccacgtcctgctgggcgaccgcggca
ggtatggggccggagccgtcgcgcgcactgatcgacgcgataatggccggcgataccgat
cgggccaggcatatcgacgaacgaatcgcatggagcatcgccccactcgccccaatgctc
ggcaatcccgagctgttcgccagctacaatacccagatggaaaagacgcgcatggctgaa
gccaactattgcgatccgggtcctgtccgcccgccttacgatgtgttccccggcgactat
gccgaggccgcgcgcgaggccgggcggcgctggcgcctgcttcgggaagaattcgccgga
gaacgggccgcggcggcgacgaaggccgtgtcgtga

DBGET integrated database retrieval system