KEGG   Sphingomonas sp. JJ-A5: BSL82_17315Help
Entry
BSL82_17315       CDS       T04967                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00010  Glycolysis / Gluconeogenesis
sphj00020  Citrate cycle (TCA cycle)
sphj00620  Pyruvate metabolism
sphj01100  Metabolic pathways
sphj01110  Biosynthesis of secondary metabolites
sphj01120  Microbial metabolism in diverse environments
sphj01130  Biosynthesis of antibiotics
sphj01200  Carbon metabolism
Module
sphj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSL82_17315
   00020 Citrate cycle (TCA cycle)
    BSL82_17315
   00620 Pyruvate metabolism
    BSL82_17315
Enzymes [BR:sphj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSL82_17315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 UPF0231
Motif
Other DBs
NCBI-ProteinID: API60822
UniProt: A0A1L3ZYX3
Position
3332251..3333519
Genome map
AA seq 422 aa AA seqDB search
MSIELKMPALSPTMEKGTLAKWLVNEGDLVKIGDLLAEIETDKATMEYEAIDEGRIASLV
IAAGTEDVPVGTVIALMAELGEVVAATRLEMADAAPAAAEASSSPAPKADIAPPPATKPP
VPLVDDAGVSATPLARRIATVKGLSLLDVTGTGARGRIVKADLGLRPLAPTAIAAPVAGA
AVATAPVHAPPAGVPVETIKLSGMRKTIARRLTESKQTVPHFYLTAHCNIDALLKLRTTL
NESLSARGIKLSVNDLVIKAMALAMARQPDVNVQFAGDEMHRFGRVDISMAVAIDGGLIT
PVIRDAASLSLSAIAMQSKQLAARARDGKLMPEDYQGGTASISNLGMYGLDEMFPVINPP
QALILGIGSGIEKPWKVDGVIALATMITATASFDHRAIDGATAARFMAALRDLLENPIRL
VC
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgaactgaagatgcccgctctgtcgccaacgatggagaagggcacacttgcc
aaatggctggtgaacgagggcgatctggtaaaaattggcgacctgctcgccgagatcgag
accgacaaggccacgatggagtatgaagccatcgacgagggccgcatcgcatcgctcgtt
atcgcagccgggacggaggatgttccggtcgggaccgtgatcgcgctgatggcggagttg
ggggaagtcgtggcggcgacccgactggagatggcggatgccgctccggcggccgccgag
gcatcgtcgtcgcctgcgcccaaggccgacatcgcgccgccacccgccaccaagcctccc
gttccgctggtcgacgatgcgggtgtcagtgcgaccccgctggcgcgccgtatcgcgacg
gtgaaggggctgtcgctgctcgacgtcaccggcaccggtgcgcgggggcggatcgtcaag
gccgacctgggtctgaggccgctggccccgacggcgatcgccgcccccgtagcgggcgct
gcggtcgccaccgcgcccgtccatgcgccgccggcgggtgtgccggtcgagacgatcaaa
ctgtcgggtatgcgcaagacgatcgcccgccgcctgaccgaatccaagcagacggtgccg
catttctacctcaccgcgcattgcaatatcgatgcgctgcttaagctgcgcaccacgctg
aacgagagcctgtcggcgcgcggcatcaagctgtcggtcaatgatctggtgatcaaggca
atggcgctggcgatggcgcggcagcccgacgtcaacgttcagttcgccggcgatgagatg
caccgtttcggccgggtcgacatatcgatggcggtggcgatcgatggcggcctgatcacg
ccggtgatccgcgacgcggcgagcctgtcgctctcggcgatcgcgatgcagagcaagcaa
ctcgccgcgcgggcgcgcgacggcaagctgatgccggaggattatcagggtggcaccgca
tccatctcgaacctcggcatgtatgggctcgacgagatgttcccagtcatcaatcccccg
caggcgctgatcctgggaatcggatcggggatcgaaaagccatggaaagtcgacggcgtg
atcgcgcttgcaacgatgattaccgcgactgcaagtttcgatcatcgtgcgatcgatggt
gcgacggccgcgcgtttcatggccgctttgcgcgacctgttggaaaatccgatccggctc
gtctgttag

DBGET integrated database retrieval system