KEGG   Sphingopyxis fribergensis: SKP52_03120Help
Entry
SKP52_03120       CDS       T03542                                 

Gene name
fadA2
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00071  Fatty acid degradation
sphk00072  Synthesis and degradation of ketone bodies
sphk00280  Valine, leucine and isoleucine degradation
sphk00310  Lysine degradation
sphk00362  Benzoate degradation
sphk00380  Tryptophan metabolism
sphk00620  Pyruvate metabolism
sphk00630  Glyoxylate and dicarboxylate metabolism
sphk00640  Propanoate metabolism
sphk00650  Butanoate metabolism
sphk00900  Terpenoid backbone biosynthesis
sphk01100  Metabolic pathways
sphk01110  Biosynthesis of secondary metabolites
sphk01120  Microbial metabolism in diverse environments
sphk01130  Biosynthesis of antibiotics
sphk01200  Carbon metabolism
sphk01212  Fatty acid metabolism
sphk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SKP52_03120 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    SKP52_03120 (fadA2)
   00640 Propanoate metabolism
    SKP52_03120 (fadA2)
   00650 Butanoate metabolism
    SKP52_03120 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SKP52_03120 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    SKP52_03120 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SKP52_03120 (fadA2)
   00310 Lysine degradation
    SKP52_03120 (fadA2)
   00380 Tryptophan metabolism
    SKP52_03120 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SKP52_03120 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SKP52_03120 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SKP52_03120 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphk04147]
    SKP52_03120 (fadA2)
Enzymes [BR:sphk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SKP52_03120 (fadA2)
Exosome [BR:sphk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SKP52_03120 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJA07553
UniProt: A0A0A7PEB0
Position
complement(634451..635632)
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPLTKAARGSFNNTLAPTLGAHAVRAAVERAGIEGGEVDDVLFGAAMQQ
GSQTMNVARLIALRSGLPVTVPGMSIDRQCSSGLMTIATAAKQIIVDRQDIAVAGGIESI
SKVSGSGKVFIETDAELIAMHKDTYMPMIGTAEVVAKRYNISREAQDEYSLQSQQRTAAA
QQAGKFADEIVACPATMAVVNKETKEVSFKDVVADKDECNRPDTTLEGLASLKPVMGEGH
TITAGNASQLADGASACVVMEAKVAEKKGLQPLGRYVGMAVAGTEPDEMGIGPVFAIPKL
LERFELKMDDIGLWELNEAFAVQVLYCRDQLGIPNELLNVNGGSISIGHPFGMTGARCVG
HALIEGKRRGVKYAVVTMCIGGGQGAAGLFEVF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgcagttatcgtctccaccgcccgtaccccgctgaccaaggcggcgcgcggt
tcgttcaacaacaccctcgccccgacgctcggcgcgcatgccgtccgcgccgcggtcgag
cgcgccggcatcgaaggcggcgaagtcgacgacgtattgttcggcgccgcaatgcagcag
ggatcgcagacgatgaacgtcgcgcgcctgatcgcgctgcgctctgggctgcccgtcacc
gtccccggcatgtcgatcgaccgccaatgctcgtcgggcctgatgacgattgcgaccgcc
gcaaagcagatcatcgtcgaccgtcaggacatcgcggttgccggcggcatcgagtcgatc
tcgaaggtcagcggcagcggcaaggtgttcatcgaaaccgacgccgagctgatcgcgatg
cacaaagacacctatatgccgatgatcggcaccgccgaggtcgtcgccaagcgttacaat
atcagccgcgaggcgcaggacgaatattcgctccagtcgcagcagcgcaccgccgccgcg
cagcaggccggcaaattcgccgacgagatcgtcgcttgcccggccaccatggcggtggtg
aacaaggaaacgaaggaagtcagcttcaaggacgtcgtcgccgacaaggacgagtgcaac
cgtcccgacacgacgctcgaagggctcgcgagcctgaagccggtgatgggcgaaggccac
acgatcaccgcgggcaacgccagccagctcgccgacggcgcttcggcgtgcgtcgtgatg
gaagccaaggtcgccgagaaaaagggcctccagccgctcggtcgttatgtcggcatggcg
gtcgcgggcaccgaacccgacgaaatgggcatcggccccgtcttcgcgatccccaagctg
ctcgaacgctttgaactcaagatggacgacatcggcctttgggaactcaacgaagccttt
gccgtgcaggttctctattgccgcgaccagctcggcatcccgaacgagctgctcaacgtc
aacggcggctcgatctcgatcggtcacccgttcggcatgaccggcgcacgctgcgtcggc
cacgcgctgatcgaaggcaagcgccgcggcgtcaaatatgccgtcgtgacgatgtgcatc
ggtggcggccagggtgcagcgggcctgttcgaggtcttctga

DBGET integrated database retrieval system