KEGG   Sphingopyxis fribergensis: SKP52_06925Help
Entry
SKP52_06925       CDS       T03542                                 

Gene name
phhA1
Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00360  Phenylalanine metabolism
sphk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphk00790  Folate biosynthesis
sphk01100  Metabolic pathways
sphk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SKP52_06925 (phhA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SKP52_06925 (phhA1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SKP52_06925 (phhA1)
Enzymes [BR:sphk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     SKP52_06925 (phhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AJA08307
UniProt: A0A0A7PK54
Position
1461156..1462028
Genome map
AA seq 290 aa AA seqDB search
MAATHIFDAPPEGVAANWTMPQNWTAFTAEQHATWRTLFDQQSAALDGYACRSFLDGLGI
LRKLKPGVPNFAELNALLKPASGWEVVAVPGWIPNEPFFEHLANKRFPAANFVRPPEQIA
YSEEPDMFHDIFGHIPMLTDPAFSDFLVAYGEAGLRAEKLGASDYLGRLWLYTVEFGLVV
EDGELRAFGGGLLSSLAETLSALTSPEPQRIWLDIERVMRTRYHFDQYQQTYFVVAGFGD
LLRATEETDFASIYRKIAGEPALEPGDVWRGDVAYEGRLPAAPASGETSQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacacatattttcgacgcaccgcccgaaggtgtcgcggccaattggacgatg
ccgcaaaactggacggccttcaccgccgagcaacatgcaacgtggcggaccttgttcgat
cagcagtcggccgcactggatggctatgcctgccggtcgtttctcgacggtcttggcatt
ctgcgtaagctgaaacccggcgttcccaacttcgccgaattgaacgcgctgttgaagccc
gcatcggggtgggaagtcgtcgcggtcccgggctggatcccgaatgaaccctttttcgag
catctcgcgaacaagcgctttcccgccgccaatttcgtccgcccgcccgagcagatcgcg
tacagcgaagagcccgacatgtttcacgacatattcggccatatcccgatgctcaccgat
ccggccttttcggactttctcgtcgcttatggcgaggcggggttgcgggccgaaaagctg
ggggcatcggactatcttgggcggttatggctctacacggtcgagtttgggctggtggtc
gaggacggcgagcttcgcgcctttggcggcgggctgctgtcgagccttgccgaaacgctg
tcggcgctgacgtcgcccgaaccgcaacgcatctggctcgatatcgagcgcgtgatgcgc
acgcggtatcatttcgaccaatatcagcagacctatttcgtcgttgcgggtttcggcgat
ttgctgcgcgcgaccgaggaaaccgactttgccagcatctaccggaaaatcgctggcgaa
ccggcgctcgaacccggggatgtctggcgcggcgatgtcgcctatgaagggcgcctgccg
gccgcgccggcaagcggagagacatcgcaatga

DBGET integrated database retrieval system