KEGG   Sphingopyxis fribergensis: SKP52_14780
Entry
SKP52_14780       CDS       T03542                                 

Definition
(GenBank) cell division protein FtsA
  KO
K03590  cell division protein FtsA
Organism
sphk  Sphingopyxis fribergensis
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sphk03036]
    SKP52_14780
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sphk04812]
    SKP52_14780
Chromosome and associated proteins [BR:sphk03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    SKP52_14780
Cytoskeleton proteins [BR:sphk04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   SKP52_14780
SSDB
Motif
Pfam: FtsA SHS2_FTSA MreB_Mbl PilM_2
Other DBs
NCBI-ProteinID: AJA09838
UniProt: A0A0A7PKS5
Position
complement(3157921..3159177)
AA seq 418 aa
MAPPRIEKIITALDVGSWKVCALIAGQTADGQLHVLGTGQRESRGVQRGYVADMEQTEHI
VREAIEQAERIAGLNIDDVWVSFSAGGLLSDVAPIESELGGHRIEREDVDDLLAAGRAGI
DPEGRMILHAQPALYTIDGLTGVKNPIGLHADRLGVDIHIIMADGAPVRNLEAAVRQAHL
DVNAVVASPIAAGLACLSDEERDLGVALVELGAAVTTVSLYAGGMLVEMASLPFGASDIT
DDIASAFGIRRSQAQRLQSFYGSASASPRDNNEIIELEPGAQANGDSPRITRAQLVAVIR
QRLDAMMGEIGRTLKDLHFVGPIGRQVVLVGGGADLKGIADYTQSALGRAARVGRPRGLH
GLPDAHSGPAFATLAGLVLYAASDPVDLRDLPMMAQDVYKPAGTSILHRLMAALKSSF
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgccgccgcgcatcgaaaagatcatcaccgcgctcgatgtcgggtcgtggaaggtc
tgcgcgctgatcgcggggcaaaccgccgacggccaactccacgtgctcggcacggggcag
cgcgaaagccgcggcgtccagcgcggttatgtcgccgacatggagcagaccgagcatatc
gtgcgcgaggcgatcgaacaggctgagcgcatcgccgggcttaatatcgacgatgtgtgg
gtcagcttttcggcgggcgggctgctcagcgacgtcgcgccgatcgaaagcgaacttggt
ggtcaccgcatcgaacgggaagatgtcgacgacctgctcgccgcggggcgcgcgggcatc
gatcccgaaggccgcatgatccttcatgcgcagcccgcgctctacacgatcgacgggctg
accggggtcaagaacccgatcggcctccacgccgaccggctcggtgtcgatatccatatc
atcatggccgacggcgccccggtgcgaaatctcgaggccgcagtccgccaggcgcatctt
gacgtcaacgccgtcgtcgcttccccgatcgcggcggggctcgcctgtctttcggacgag
gaacgtgaccttggcgtcgcgctcgtcgaactcggcgcggcggtgaccaccgtgtcgctc
tatgccggcgggatgctcgtcgaaatggcgtcgctgccttttggcgccagcgacatcacc
gacgacatcgcctcggccttcggtatccggcgcagccaggcacagcggctccagagtttc
tacggctcggcctcggccagtccgcgcgacaataatgagatcatcgagctcgaacccggc
gcgcaggccaacggggattccccgcgcatcacgcgcgcgcaattggtcgcggtgatccgc
cagcggctcgatgcgatgatgggcgagatcggccggacgctcaaggatctgcatttcgtc
ggtcccatcgggcgccaggtcgtgctcgtcggcggcggcgccgacctcaaaggcatcgcc
gactacacgcaaagcgcgctcggccgcgccgcacgcgtcgggcgaccgcgcggcttgcac
ggactgcccgatgcgcatagtggccctgctttcgcgacgctcgcgggtctggttctctat
gccgcgtcggaccccgtcgacctccgcgatctgccgatgatggcacaggatgtgtacaag
ccggcaggaacctcgatcctccaccggctgatggccgcattgaaaagcagtttttag

DBGET integrated database retrieval system