KEGG   Sphingopyxis fribergensis: SKP52_15210Help
Entry
SKP52_15210       CDS       T03542                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00620  Pyruvate metabolism
sphk00630  Glyoxylate and dicarboxylate metabolism
sphk01100  Metabolic pathways
sphk01110  Biosynthesis of secondary metabolites
sphk01120  Microbial metabolism in diverse environments
sphk01200  Carbon metabolism
Module
sphk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SKP52_15210 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SKP52_15210 (glcB)
Enzymes [BR:sphk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SKP52_15210 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AJA09921
UniProt: A0A0A7PIF6
Position
complement(3250110..3252206)
Genome map
AA seq 698 aa AA seqDB search
MTIFLDRSGLSVDSRLTDFIEQRALPGTGLDADKFWSDFAGLLGKFAPENAALLAKREDM
QAQIDAWHEARSGQPHDAAAYQTFLREIGYLVPAPAPFKIGTQNVDPEIATMAGPQLVVP
ALNARFALNAANARWGSLYDALYGTDALDAPPAKPGGYDAARGAAVIARAKAFLDEAVPL
ASGSWADWQGGQLILADPTQWVGSKPGGILLRHNGLHIELVIDPASAIGKTDPAGIADVI
LEAALTTIIDLEDSVAAVDGEDKTLGYTNWLGLMRGDLTESFAKGGATVTRAMAADREWT
SPAGDPVVLHGRSVMFVRNVGHLMTTPMIKLPNGAEAPEGLCDAVITSLCALHDLKGLGH
LNNSRAGSIYIVKPKQHGPEECGFTDRLFDAVEDMLGLARHTMKVGVMDEERRTSANLAA
CIHAVKDRIVFINTGFLDRTGDEIHTSMRAGPMIPKGEMKASDWIASYEDRNVRIGLACG
LSGKAQIGKGMWAMPDLMKAMLETKIGHPKSGANTAWVPSPTAATLHALHYHQIDVFARQ
REIVGEAVPSLDRLLNIPVATGRNWSEAEITRELDNNCQGILGYVVRWIDQGVGCSKVPD
IDDIGLMEDRATLRIASQALANWLLHGICTPQQVDAALARMAAKVDAQNADDALYEKLTP
DGIAYQAARALIFEGMTQPSGYTEPLLHKFRQAKKAAA
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgactatatttctcgaccgttccggcctgtccgtcgattcgcgactgaccgattttatc
gagcagcgcgcgctgccggggacggggctcgacgccgataaattctggagcgatttcgcc
ggattgctcggcaagttcgctcccgaaaacgcagcattgctggcgaagcgcgaggatatg
caagcgcagatcgatgcctggcacgaagcgcgttccggccaaccgcatgacgccgccgcc
tatcagacgttcctgcgcgagatcggctaccttgttcctgcgcccgcgccgttcaaaatc
ggcacgcaaaacgtcgatcccgaaatcgcgacgatggcagggccgcagctcgttgtgccc
gcgctcaacgcccgcttcgcgctcaacgccgccaatgcgcgctggggcagcctctacgat
gcgctgtacggcaccgacgcgctcgacgcgccgcccgcgaagcccggcggctatgatgcc
gcccgcggggcggcggtgatcgcgcgcgccaaggcattcctcgacgaagcggtgccgctg
gcgtcgggaagctgggccgactggcagggcggtcagctcatcctcgccgatcccacgcaa
tgggtcggcagcaagcccggcggcatcctgctccgccacaacggcctgcacatcgaactg
gtgatcgatccggcgagcgcgatcggcaagaccgaccccgcggggatcgccgatgtcatc
cttgaagccgcgctgacgacgatcatcgacctcgaagacagcgtcgccgcggtcgacggc
gaggacaagacgctcggctacaccaactggctcggcctgatgcgcggcgacctgaccgaa
agcttcgccaagggcggggcgacggtgacgcgcgcgatggcggccgaccgcgaatggacg
tcaccggcaggcgatccggtcgtcctgcatggccgcagcgtgatgttcgtgcgcaacgtc
ggccatctgatgacgacgccgatgatcaaactgccgaacggcgccgaagcgcccgagggt
ctgtgcgacgccgtcatcaccagcctctgcgcgctccacgatctcaagggtctcgggcat
ctgaacaacagccgcgctggcagcatttatatcgtcaagccgaagcagcatggaccggaa
gagtgcggtttcaccgatcggctgttcgatgcggtggaggatatgctgggcctcgcgcgc
cacacgatgaaggtcggcgtgatggacgaggaacgccgcaccagcgccaacctcgcggcg
tgcatccacgcggtgaaggaccgcattgtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgaaatccacacctcgatgcgcgcgggtcctatgatcccgaagggcgagatgaag
gcgagcgactggattgcctcctacgaggatcgcaatgtccgcatcggcctcgcctgcggc
ctttcgggcaaggcgcagatcggcaagggcatgtgggcgatgcccgacctgatgaaagcc
atgctggaaaccaagatcggccaccccaagagcggcgccaacaccgcctgggtcccttcg
ccgaccgccgcgacgctccacgcgctccattaccatcagatcgacgttttcgcgcgtcag
cgggagatcgtgggcgaagcggtgccctcgctcgatcgcctgctcaacatccccgttgcc
accggccgcaactggagcgaggccgaaatcacgcgcgaactcgacaataattgccagggc
attctcggctatgtggtgcgctggatcgatcagggggtcggttgctccaaggtgcccgac
atcgacgacatcggcctgatggaagatcgcgcgacgctgcggatcgccagccaggcgctc
gccaactggctgctccacggcatctgcaccccgcaacaggtcgacgccgcgctggcgcgc
atggcggcaaaggtcgatgcgcagaacgccgacgatgcgctctacgaaaagctgacgccc
gacggaattgcctatcaggcggcgcgggcgttgatcttcgagggcatgacccaaccgtcg
ggctacaccgaaccgttgttgcacaagttccggcaggcgaagaaggcggcggcgtga

DBGET integrated database retrieval system