KEGG   Sphingopyxis fribergensis: SKP52_18390Help
Entry
SKP52_18390       CDS       T03542                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00010  Glycolysis / Gluconeogenesis
sphk00020  Citrate cycle (TCA cycle)
sphk00620  Pyruvate metabolism
sphk01100  Metabolic pathways
sphk01110  Biosynthesis of secondary metabolites
sphk01120  Microbial metabolism in diverse environments
sphk01130  Biosynthesis of antibiotics
sphk01200  Carbon metabolism
Module
sphk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SKP52_18390 (pckA)
   00020 Citrate cycle (TCA cycle)
    SKP52_18390 (pckA)
   00620 Pyruvate metabolism
    SKP52_18390 (pckA)
Enzymes [BR:sphk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SKP52_18390 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_25
Motif
Other DBs
NCBI-ProteinID: AJA10548
UniProt: A0A0A7PMV6
Position
complement(3892056..3893657)
Genome map
AA seq 533 aa AA seqDB search
MTNIVIGNSSVETQANVAENWGTSALIEDAVRHGEGLLAKDGPLVVATGKHTGRSAKDKF
IVQDDETANTIWWGKTNVPMTPDHFAALKADFFAHLAERPRLYRQQLFGGSQAEHRVAVQ
VVTEFAWHSQFIRTLLVRPTAEELAAFAAEYTIIDLPSFRADPAKHGTRTETVVAVNFTE
KLVLIGGTAYAGEMKKSVFGILNYLLPVKGVMPMHCSANMGPAGDTAVFFGLSGTGKTTL
SADASRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSPEAEPEIFATTKRFGTVLENVVMD
PETRELDFDDASLAENSRGSYPIDFIPNTSEANMGPVPTNIIMLTADAYGVLPPIAKLTP
DQAMYHFLSGYTARVAGTEIGVTEPEATFSTCFGAPFMPRHPSVYGNLLKERIAKGGVQC
WLVNTGWTGGMATMDGIKRMPIKATRALLNAALDGSLNNAEFRKDPNFGFMVPVAVPGVD
SALLDPREAWADRAAYDRTAQTLVGQFIDNFAQFADHVDEGVRQAAPQAAVAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatcgtgatcggcaacagcagcgtggaaacgcaggcgaatgttgcggaaaac
tggggcacgtcggcgctgatcgaggatgcggttcgccacggcgagggcctgctcgcaaag
gacggcccgctcgtcgtcgcgacgggcaagcacaccggccgcagcgccaaggacaaattc
atcgtccaggacgacgagaccgccaacacgatctggtggggcaagaccaatgtgccgatg
acgcccgatcatttcgccgcgctcaaggccgacttcttcgcgcacctcgccgaacgtccg
cgcctctatcgccagcagctgttcggcggctcgcaggcggagcaccgcgtcgcggtgcag
gtcgtcaccgaattcgcctggcacagccagttcatccgcacgttgctcgttcgcccgacg
gccgaggaactggcggcgttcgcggccgaatatacgattatcgacctgccgagctttcgc
gccgatcccgcaaaacatggcacgcggaccgagaccgtcgtcgcggtgaactttaccgaa
aagctcgtgctgatcggcggcaccgcttatgccggcgagatgaagaagtcggttttcggt
atcctgaactatctgctcccggtgaagggcgtgatgccgatgcactgttcggcgaacatg
ggaccggcgggcgacaccgcggtcttcttcggcctcagcggcacgggcaagacgacgctg
tcggccgacgcctcgcgtacgctgatcggcgacgacgaacatggctggtcggacaccgcg
gtcttcaatttcgagggcggctgctacgccaagatgatccgcctgtcgcccgaggccgag
cccgagattttcgcgacgacgaaacgcttcggcacggtgctcgaaaatgtcgtgatggat
cccgaaacgcgcgaactcgatttcgacgacgcgagcctcgccgaaaacagccgcggttcg
tacccgatcgatttcattccgaacacgtcggaagcgaatatgggtccggtgccgaccaac
atcatcatgctcaccgccgatgcctatggcgtgctgcctccgatcgcgaagctgaccccc
gatcaggcgatgtatcacttcctctcgggctacactgcgcgcgtcgcgggcaccgaaatc
ggcgtgaccgagcccgaggcgaccttttcgacctgtttcggcgcacccttcatgccgcgc
catccgtcggtctatggcaatttgctgaaagagcgcatcgccaagggcggcgtccagtgc
tggctcgtcaacaccggctggaccggcggcatggcgacgatggacggcatcaagcggatg
ccgatcaaggcgacgcgcgcgctgctcaatgccgcgctcgacggcagcctcaacaacgcc
gaattccgcaaggatcccaattttggcttcatggtccctgtcgcagtgccgggtgtcgac
agcgccttgctcgatccgcgcgaagcctgggccgacagggctgcctatgaccgcaccgcg
caaacgctcgtcggccagttcatcgacaatttcgcgcaatttgcggaccatgtcgacgaa
ggcgtccgccaagccgcgccgcaggcggccgtcgcagcataa

DBGET integrated database retrieval system