KEGG   Sphingopyxis fribergensis: SKP52_24600Help
Entry
SKP52_24600       CDS       T03542                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00360  Phenylalanine metabolism
sphk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SKP52_24600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sphk01002]
    SKP52_24600
Enzymes [BR:sphk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     SKP52_24600
Peptidases and inhibitors [BR:sphk01002]
 Metallo peptidases
  Family M20
   SKP52_24600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AJA11757
UniProt: A0A0A7PUI9
Position
pSfKp5.2:186962..188161
Genome map
AA seq 399 aa AA seqDB search
MATVLDKNPAGESASFYDEFVALRRDIHRHPELGFEEVRTSDIVAAKLTEWGYAVTRGLG
GTGVVGQLVHGNGGKVLGLRADMDALPIQEQGQAEWRSDTPGVMHACGHDGHTVMLLAAA
KRLAEDPGFSGTLNLIFQPAEEVGTAGAGAARMIADGLFETFPCDAVFAMHNAPTVPAGM
LLFREGPMLASSDAVNVVLKGRGGHGAMPHTAVDPVVGAASLIMALHTIVSRNVDPLRTG
VITVGVVRAGDARNVIPDSARLEITVRALDPAVRDLLHERICRVVADQASSFGLEAEVDY
DRGYPPVVNSVAETRFASQVAADVFGAGRVMTDCPAQTGGEDFAFMLEKKPGCYLLIGNG
AAGTPHACMVHNPHYDFNDAVIPTGAEYWVQLARRYLAQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacggtcctggacaaaaaccccgcgggtgaatcggcgagcttctatgacgagttc
gtcgcgttgcgccgcgacatccatcgccacccggaactgggcttcgaggaggttcgcacc
agcgacatcgtcgccgcgaagctgaccgaatggggctatgccgtcacgcgcggcctcggc
gggaccggcgtggtcgggcaattggtgcacggcaacggcggcaaggtgctgggcctgcgc
gccgacatggacgcgctgccgatccaggagcagggccaggctgaatggcgcagcgatacc
cccggcgtgatgcacgcctgcggccatgatggccataccgtcatgctgctcgccgcggcg
aaacgcctggccgaggacccgggcttcagcggaacgctcaacctgattttccagcccgcc
gaggaggtgggcacggcgggagcgggcgccgcgcggatgatcgccgacggcctgttcgag
acattcccctgcgacgcggtgttcgctatgcacaacgcgccgaccgtgccggccggtatg
ctgctgttccgcgaggggccgatgctggcctcgtccgacgcggtgaacgtcgtgctgaaa
ggccgcggcgggcatggcgccatgccgcataccgcagtcgacccggtcgtcggcgcggcc
agcctgatcatggcgctccatacgatcgtgtcgcgcaacgtcgacccgctgagaaccggg
gtgatcaccgttggggtggtcagggccggtgacgcgcgcaacgtgatccccgacagcgcc
cgtctggagataacggtgcgcgcgctcgatccggcagtgcgcgacctgctccatgagcgt
atttgccgcgtcgtggccgaccaggccagcagcttcgggctggaggcggaggttgactat
gatcgcggctatccgccggtagtcaattcggtggcggaaacccgcttcgccagccaggtc
gcggcggatgtcttcggggccgggcgggtgatgaccgactgcccggcgcagaccggtggc
gaggacttcgccttcatgctcgagaaaaaaccgggctgctaccttctgatcggcaacggc
gcggcggggacgccgcatgcctgcatggtccacaacccccattacgatttcaacgacgcc
gtcatcccgaccggagccgaatattgggtgcaactggcacgtcggtacctggcccagtga

DBGET integrated database retrieval system