KEGG   Sphingopyxis sp. LPB0140: LPB140_11165Help
Entry
LPB140_11165      CDS       T04602                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphl  Sphingopyxis sp. LPB0140
Pathway
sphl00071  Fatty acid degradation
sphl00072  Synthesis and degradation of ketone bodies
sphl00280  Valine, leucine and isoleucine degradation
sphl00310  Lysine degradation
sphl00362  Benzoate degradation
sphl00380  Tryptophan metabolism
sphl00620  Pyruvate metabolism
sphl00630  Glyoxylate and dicarboxylate metabolism
sphl00640  Propanoate metabolism
sphl00650  Butanoate metabolism
sphl00900  Terpenoid backbone biosynthesis
sphl01100  Metabolic pathways
sphl01110  Biosynthesis of secondary metabolites
sphl01120  Microbial metabolism in diverse environments
sphl01130  Biosynthesis of antibiotics
sphl01200  Carbon metabolism
sphl01212  Fatty acid metabolism
sphl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB140_11165
   00630 Glyoxylate and dicarboxylate metabolism
    LPB140_11165
   00640 Propanoate metabolism
    LPB140_11165
   00650 Butanoate metabolism
    LPB140_11165
  Lipid metabolism
   00071 Fatty acid degradation
    LPB140_11165
   00072 Synthesis and degradation of ketone bodies
    LPB140_11165
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPB140_11165
   00310 Lysine degradation
    LPB140_11165
   00380 Tryptophan metabolism
    LPB140_11165
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPB140_11165
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPB140_11165
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPB140_11165
Enzymes [BR:sphl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPB140_11165
Exosome [BR:sphl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPB140_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: APG63253
UniProt: A0A1L3JDX3
Position
complement(2351362..2352573)
Genome map
AA seq 403 aa AA seqDB search
MSEAFIFDAVRSPRGKGRSDGALHEITPLDLSAQVLASVRERNNLPAEAVEDISFGCVSP
VGEQGAVITRTAALQAGYAETTSGIQVNRFCGSGLEASNIAAAKVKAGEADLTIGGGIES
MSRVPMGSDGGAWPVDPRSAIANYFIPQGISADLIATKYGYSRDDVDAYAMESQKRAARA
WAEKRFANSILPIRDVIGEVVLDHDELMRPETDMQSLGALAPAFAMMGQAMPGFDDIAKM
RYPDIENINHVHHAGNSSGIVDGSAAVLIGNDVAAKKYDLKPRARIVSMASIGSEPTIML
TGPEFAAQKALTRAGMSASDIDLWELNEAFASVVLRFMDAMKVDHSDINVNGGAIAMGHP
LGATGAMILGTVVDELERSGKSTALITLCIGAGMGTATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcatttatttttgacgcggtgcgcagcccgcgcggcaaggggcgcagcgat
ggcgcattgcacgaaatcaccccattggacctttccgctcaggttttggccagcgtgcgg
gaacgcaacaatcttcctgccgaggcggtagaggatatttcatttggctgtgtgtccccc
gtgggtgagcaaggcgcggtgataacccgcaccgccgcattgcaggcgggatatgccgaa
acaacatcgggaattcaggtaaaccgtttttgcggttcggggcttgaggcatcaaatatc
gcggcagccaaggtaaaggcgggtgaggccgatttaaccattggcggcggcattgaatcg
atgagccgcgttcccatgggttcagatggcggcgcatggccggttgatccgcgctctgcc
attgccaattattttattccgcagggtatttctgccgatttaatcgccaccaaatatggc
tatagccgcgatgatgtggacgcatatgcgatggaaagccaaaaacgcgccgcgcgcgca
tgggccgaaaaacgctttgccaattccattttgcccattcgtgatgtgattggtgaggtg
gtgttggaccatgatgagttaatgcgtcctgaaaccgacatgcaatcattgggcgctctt
gcccctgcatttgcgatgatggggcaagcgatgcccggttttgatgatatcgccaaaatg
cgctatcccgatattgaaaatataaatcatgtgcatcatgcgggtaatagttcgggcatt
gtggatggttcagccgccgtgttaatcggcaatgatgttgcggccaaaaaatatgatttg
aaaccgcgtgcacgcattgtttccatggccagcattggttcagagccaaccatcatgtta
accggccccgaatttgccgcgcaaaaggcattgacccgcgcggggatgagcgcgtcggac
attgatttgtgggaattgaatgaggcttttgcctcggtagtattacgtttcatggatgcg
atgaaagttgaccatagcgatattaacgtcaatggcggcgcaattgccatgggccaccca
ttgggcgcgaccggcgcgatgattttgggaacagtggttgatgagttggagcgttcgggc
aaatcgaccgcgcttatcaccctatgcattggtgcaggcatgggcaccgccaccatcatt
gagcgcgtataa

DBGET integrated database retrieval system