KEGG   Sphingomonas sp. MM-1: G432_04650Help
Entry
G432_04650        CDS       T02498                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    G432_04650
Enzymes [BR:sphm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     G432_04650
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     G432_04650
    1.1.1.-  
     G432_04650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N 3HCDH_N TrkA_N MlaD UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGH48657
UniProt: M4SDD1
Position
complement(969863..970897)
Genome map
AA seq 344 aa AA seqDB search
MKAADFTAPGHIGMRSDATPPMPAPGEVIVAVEACGICGSDLHMYRNDSYRDRLTRRTPE
GYTVPGHEFAGRIAALGEGVEGWQLGQRVVGVTGLGGGMADRVAVPANPYQLVAMPDGVS
FAEAATTEPMADGLQMVRKAAIRDGENVAVFGVGIIGLGVIQAIRARGVPVGRIVAIDVQ
QARLDKALEIGATDIVNPRDGDVFAQVAAVCGTEEGYRGISANIGVVFDCAGYIAHMAGP
PPLETALRLIALRDGRIICFGGFEGAMTIDMGPIIQKEPAILGSNGYAPEELVEALELMR
SGAVDRRTLISHRLPLSAIGEAFETQCRPDAVKVMLEIGPEAAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcagccgatttcaccgcgcccggccatatcgggatgcggagcgacgcgaccccg
cccatgcccgcgccgggcgaggtgatcgtcgcggtggaggcatgcggcatctgcggatcg
gatctgcacatgtatcgtaacgacagctatcgcgaccggctgacccggcggacgcccgaa
ggctatacggtgccgggtcacgaattcgccggccgcatcgcggcgctgggcgagggcgtc
gagggctggcagctcggccagcgcgtggtgggcgtgacggggctgggcggcggcatggcc
gatcgggtggcggtgccggccaatccctatcagctcgtcgcgatgccggatggcgtgagc
ttcgccgaggccgcgaccaccgagcccatggccgatggcttgcagatggtgcgcaaggcg
gcgatccgcgatggcgagaatgtcgcggtgttcggcgtcggcatcatcgggttgggcgtg
atccaggcgatccgcgcgcgcggcgttccggtggggcggatcgtcgccatcgacgtgcag
caggcgcggctggacaaggcgctggaaatcggcgcgaccgatatcgtcaacccgcgcgac
ggcgatgtcttcgcccaggtcgcggcggtctgcggcaccgaggaggggtatcgcggcatt
tccgccaatatcggcgtggtgttcgactgcgccggctatatcgcccacatggccggcccg
ccgcctctggagacggcgctgcgcctgatcgcgctccgggacgggcggatcatctgcttc
ggcggattcgaaggggcgatgaccatcgacatggggccgatcatccagaaggagccggcg
atcctgggatcgaacggctatgcgcccgaggagctggtggaggcgctggagctgatgcgc
agcggcgccgtcgatcgccgcacgctgatatcgcaccgcctgccgctgtccgcgatcggc
gaggcgttcgaaacgcagtgccggccggatgcggtgaaggtgatgctggagatcgggccg
gaggcggcggcgtga

DBGET integrated database retrieval system