KEGG   Sphingomonas sp. MM-1: G432_08110Help
Entry
G432_08110        CDS       T02498                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    G432_08110 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sphm03011]
    G432_08110 (rplV)
Ribosome [BR:sphm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    G432_08110 (rplV)
  Bacteria
    G432_08110 (rplV)
  Archaea
    G432_08110 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGH49347
UniProt: M4SFF4
Position
complement(1678466..1678849)
Genome map
AA seq 127 aa AA seqDB search
MSKPASPRKVGDKEALAVATTVRGSPQKLNLVAALIRNKKAGDALNILAFSKKAMAVDVR
KVLQSAIANAENNHNLDVDALVVKEASVGKGLVMKRFATRARGRSTRIVKPFSRLRVVVR
EQEEAGE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcctgcatccccccgcaaggtcggcgataaggaagcgctggcggtggccacc
accgtccgcggctcgccgcagaagctgaacctggtcgcggccctcatccgcaacaagaag
gccggcgacgcgctcaacatcctcgctttctccaagaaggcgatggcggttgacgtccgc
aaggtgcttcagagcgcgatcgccaacgccgagaacaaccacaatctcgatgtggacgcg
ctcgtcgtgaaggaagcctcggtcggcaagggcctcgtcatgaagcgcttcgccacccgc
gcccgcggccgttccacccgcatcgtcaagccgttctcgcgcctgcgcgtggtcgtccgc
gagcaggaagaggctggagaataa

DBGET integrated database retrieval system