KEGG   Sphingomonas sp. MM-1: G432_09245Help
Entry
G432_09245        CDS       T02498                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sphm  Sphingomonas sp. MM-1
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    G432_09245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGH49574
UniProt: M4S518
Position
complement(1912089..1913099)
Genome map
AA seq 336 aa AA seqDB search
MEAAALSLPLLIGLIGVALLFDFLNGLHDAANSIATIVSTRVLRPQYAVVWAAFFNFIAF
LFFGLHVAETVGRGIVSAEIVDAHVIFGALMGAISWNLITWGLGIPSSSSHALIGGLLGA
GTAKAGLHAVVWSGVFKTAAAIVLSPTIGLVLALVLVLITSWAFVKATPTLADRWFRKLQ
LVSASLYSLGHGGNDAQKTMGIIAVLLYSQGMLSGGFHVPFWVVISCQAAMGLGTLMGGW
KIVHTMGSKITRLTPAQGFCAETGGALTLFGATWLGVPVSTTHTITGAIVGVGSARRMSA
VRWNIASRIVIAWVVTLPAAAAIGALFYWLAGLFAW
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgctgctctttcgctgccgctgctgatcgggctgatcggcgtcgccttgctg
ttcgatttcctgaacggcctgcacgatgccgccaactcgatcgcgacgatcgtctccacc
cgggtgctccgcccgcaatatgcggtggtctgggccgccttcttcaacttcatcgccttc
ctcttcttcggcctgcatgtcgccgagacggtggggcgcggcatcgtcagcgcggagatc
gtcgatgcccatgtgatcttcggcgcgctgatgggggcgatatcgtggaacctcatcacc
tgggggctgggcatcccttccagcagcagccacgcgctgatcggcggccttctgggcgcc
ggcactgccaaggcggggctgcacgcggtggtgtggagcggcgtgttcaagacggccgcc
gccatcgtgctgtcgcccaccatcggcctggtgctggcgctggtgctggtgctcatcacc
tcatgggcgttcgtgaaggccacgcccacgcttgccgatcgctggttccgcaagctccag
ctcgtctcggcatcgctctattcgctcggccatggcggcaatgacgcgcagaagacgatg
gggatcatcgccgtgctgctttattcgcaggggatgctgagcggcggatttcacgtgccc
ttttgggtggtgataagctgccaggcggcgatggggctgggcacgctgatgggcggatgg
aagatcgtccacaccatgggatcgaagatcacccgcctcaccccggcgcagggcttctgc
gcggaaacgggcggcgcgctcaccctgttcggcgcgacatggctgggggtgccggtatcg
accacgcacaccatcaccggcgcgatcgtcggcgtgggatcggcacggcgcatgtcggcc
gtgcgctggaacatcgccagccgcatcgtcatcgcctgggtggtgacgctgccggcggcg
gccgcgatcggcgcgctcttctactggctggcgggtcttttcgcctggtga

DBGET integrated database retrieval system