KEGG   Sphingomonas sp. MM-1: G432_11360Help
Entry
G432_11360        CDS       T02498                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00071  Fatty acid degradation
sphm00072  Synthesis and degradation of ketone bodies
sphm00280  Valine, leucine and isoleucine degradation
sphm00310  Lysine degradation
sphm00362  Benzoate degradation
sphm00380  Tryptophan metabolism
sphm00620  Pyruvate metabolism
sphm00630  Glyoxylate and dicarboxylate metabolism
sphm00640  Propanoate metabolism
sphm00650  Butanoate metabolism
sphm00900  Terpenoid backbone biosynthesis
sphm01100  Metabolic pathways
sphm01110  Biosynthesis of secondary metabolites
sphm01120  Microbial metabolism in diverse environments
sphm01130  Biosynthesis of antibiotics
sphm01200  Carbon metabolism
sphm01212  Fatty acid metabolism
sphm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G432_11360
   00630 Glyoxylate and dicarboxylate metabolism
    G432_11360
   00640 Propanoate metabolism
    G432_11360
   00650 Butanoate metabolism
    G432_11360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G432_11360
   00072 Synthesis and degradation of ketone bodies
    G432_11360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    G432_11360
   00310 Lysine degradation
    G432_11360
   00380 Tryptophan metabolism
    G432_11360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G432_11360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G432_11360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G432_11360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphm04147]
    G432_11360
Enzymes [BR:sphm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     G432_11360
Exosome [BR:sphm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G432_11360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGH49995
UniProt: M4S1X7
Position
complement(2389489..2390673)
Genome map
AA seq 394 aa AA seqDB search
MSSDPVVILSYARTPMGGFQGALAGASATDLGATAVRAAVERAGVDPAAIERIYMGCVLP
AGLGQAPARQAALGAGLPQSVEATTVNKMCGSGMQAAIMAAEAIAAGSADIIVAGGMESM
TNAPYALPKHRSGARIGHDRVIDTMMMDGLEDAYDKGKPMGAFAEDTARDYQFTREEQDE
YALRSLSRAKAAIGSGAFAGEIVAVEVVTRKGPVTVDTDEQPGNAMPDKIPNLKPAFARD
GTITAASSASISDGAAALVMTRQSTADAQGLKPVARIVAQAAHAHAPALFTTAPVDAMRK
VLEKAGWSVDDVDLFEVNEAFAVVPMIAAKDLGIPVDKLNVNGGATALGHPIGASGARII
ATLVAALQQRGLKRGVASLCIGGGEATAVALELC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgatcccgtggtgatcctgtcctacgcgcggacgccgatgggcggcttccag
ggcgcgctggcgggggcatccgcgaccgatctgggcgcgacggcggtgcgcgcggcggtg
gagcgggccggcgtcgatcccgccgcgatcgagcggatctacatgggctgcgtgctgccg
gccgggctgggccaggcgccggcgcggcaggcggcgctgggcgcgggcctgccccagtcg
gtcgaggccacgaccgtcaacaagatgtgcggatcgggcatgcaggcggcgatcatggcg
gcggaggcgatcgccgccggatcggccgacatcatcgtcgcgggcgggatggagagcatg
accaacgcgccctatgcgctgcccaagcaccgttcgggcgcgcgcatcggccatgaccgc
gtgatcgatacgatgatgatggacgggctggaggatgcctatgacaagggcaagccgatg
ggcgccttcgccgaggatacggcgcgcgactatcagttcacccgcgaggagcaggacgaa
tatgccctccgctcgctgtcccgcgccaaggccgcgatcgggagcggcgccttcgccggc
gagatcgtggcggtcgaggtcgtcacccgcaaggggccggtgacggtcgacaccgacgaa
cagcccggcaacgccatgccggacaagatacccaatctgaagcccgctttcgccagggac
ggcacgatcacggccgccagctccgcctccatctccgacggcgccgccgccctggtgatg
acgcggcaaagcacggcggacgcacaggggctgaagccggtggcgcggatcgtggcccag
gcggcgcacgcccatgccccggctctgttcaccaccgccccggtggatgcgatgcgcaag
gtgctggaaaaggcggggtggagcgtggacgatgtcgacctgttcgaggtgaacgaggcc
ttcgccgtggtgccgatgatcgccgccaaggacctcggcatcccggtggacaagctgaac
gtcaatggcggggcgacggcgctcggccatcccatcggcgcatcgggcgcgcggatcatc
gccacgctggtcgcggcgctccagcagcgcgggctgaagcgcggcgtcgccagcctttgc
atcggcggcggcgaggccacggccgtcgccctcgaactctgctga

DBGET integrated database retrieval system