KEGG   Sphingomonas sp. MM-1: G432_14485Help
Entry
G432_14485        CDS       T02498                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00071  Fatty acid degradation
sphm00072  Synthesis and degradation of ketone bodies
sphm00280  Valine, leucine and isoleucine degradation
sphm00310  Lysine degradation
sphm00362  Benzoate degradation
sphm00380  Tryptophan metabolism
sphm00620  Pyruvate metabolism
sphm00630  Glyoxylate and dicarboxylate metabolism
sphm00640  Propanoate metabolism
sphm00650  Butanoate metabolism
sphm00900  Terpenoid backbone biosynthesis
sphm01100  Metabolic pathways
sphm01110  Biosynthesis of secondary metabolites
sphm01120  Microbial metabolism in diverse environments
sphm01130  Biosynthesis of antibiotics
sphm01200  Carbon metabolism
sphm01212  Fatty acid metabolism
sphm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G432_14485
   00630 Glyoxylate and dicarboxylate metabolism
    G432_14485
   00640 Propanoate metabolism
    G432_14485
   00650 Butanoate metabolism
    G432_14485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G432_14485
   00072 Synthesis and degradation of ketone bodies
    G432_14485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    G432_14485
   00310 Lysine degradation
    G432_14485
   00380 Tryptophan metabolism
    G432_14485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G432_14485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G432_14485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G432_14485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphm04147]
    G432_14485
Enzymes [BR:sphm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     G432_14485
Exosome [BR:sphm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G432_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGH50616
UniProt: M4S4C3
Position
complement(3048825..3050000)
Genome map
AA seq 391 aa AA seqDB search
MRDAVIVSTARTPIGRAYRGAFNATPSPTLAAHAIRAAVERARLDPAEVDDVVMGAALQQ
GVQATIGRTAALRAGLPVTVAGMSVDRQCASGLEAIAIAARKVIVDKEDVVVAGGVESIS
LVQTRDMRVGFDPELIAMHDDVYMPMLQTAEVVANRYGISRAAQDEYALQSQQRTAAAQA
AGRFDAEIIPVTATMTVTDKATGEVSQRQVTLAKDEGNRPETTLEGLASLQPVVGPQGFI
TAGNASQLSDGASACVVMERGLAEARNLAPLGRFVGMAVAGTKPDEMGIGPVFAIPKLLE
RFDLRMADIGLWELNEAFAVQVIYCRDTLGIPNDLMNVNGGAISIGHPYGMSGARMVGHA
LIEGKRRGVKHVVVTMCVGGGMGAAGLFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgccgtgatcgtttccaccgcccgcacgccgatcggccgtgcctatcgcggt
gccttcaacgccaccccctcccccacgctggccgcgcacgcgatccgtgcggcggtggag
cgcgcccggctcgatccggcggaagtcgacgatgtggtgatgggcgcggcgctccagcag
ggcgtgcaggccaccatcggccgcaccgcggcgctgcgcgcgggcctgcccgtcaccgtc
gccggcatgtcggtggaccggcaatgcgcctcggggctggaagccatcgccatcgccgcg
cgcaaggtgatcgtcgacaaggaggatgtcgtcgtggccggcggcgtcgaatccatctcg
ctggtgcagaccagggacatgcgcgtcggcttcgatccggaactgatcgccatgcacgac
gacgtctacatgccgatgctgcagacggcggaggtcgtcgccaaccgctacggcatcagc
cgcgcggcgcaggacgaatatgccctccagtcgcagcagcgcaccgccgccgcccaggcc
gccggacgcttcgacgcggagatcatccccgtcaccgcgacgatgacggtgacggacaag
gccacgggcgaggtttcgcaaaggcaggtcacgctggccaaggacgaaggcaaccgcccg
gaaaccacgctggaagggctggcctcgctccagcccgtggtcggcccgcagggcttcatc
accgccggcaatgccagccagctatccgatggcgcatcggcctgcgtggtgatggagcgc
ggcctggcggaagcccgcaacctcgcgccgctcggccgcttcgtcggcatggcggtggcg
ggcaccaagcccgacgagatgggcatcggccccgtcttcgccatccccaagctgctcgaa
cgcttcgacctgcgcatggccgatatcggcctgtgggagctgaacgaggccttcgccgtg
caggtgatctactgccgcgacacgctgggcatccccaacgacctcatgaacgtgaacggc
ggcgcgatctcgatcggccacccctatggcatgtcgggcgcccgcatggtcggccacgcg
ctgatcgagggcaagcggcgcggggtgaagcatgtcgtcgtcaccatgtgcgtcggcggc
ggcatgggcgcggccggcctgttcgaggtgctgtaa

DBGET integrated database retrieval system