KEGG   Sphingomonas sp. MM-1: G432_17605Help
Entry
G432_17605        CDS       T02498                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00061  Fatty acid biosynthesis
sphm00071  Fatty acid degradation
sphm01100  Metabolic pathways
sphm01212  Fatty acid metabolism
sphm02024  Quorum sensing
Module
sphm_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    G432_17605
   00071 Fatty acid degradation
    G432_17605
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G432_17605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sphm01004]
    G432_17605
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphm04147]
    G432_17605
Enzymes [BR:sphm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     G432_17605
Lipid biosynthesis proteins [BR:sphm01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   G432_17605
Exosome [BR:sphm04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   G432_17605
  Exosomal proteins of breast cancer cells
   G432_17605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGH51239
UniProt: M4S9P9
Position
complement(3746106..3747746)
Genome map
AA seq 546 aa AA seqDB search
MTANHYAAKPWLRLFPEGQPHDHQARFGDMLAAFRAAVADAADRTAIRFSGSGISFGALD
AKSDRLAGWAAAHGVKPGDRIAIILQNVPAAAIATVAAWKLGAIPVPGNPMYRAAEIARQ
FEDSRPALLICHEGHAATIGEALAIIGDGGRPVLTVPEDGGPGDAALPGSLAAAMAEELV
PPPSPTIAPDDLGLLLYTSGTTGVPKAAMIRHESLAWNSEAMSLWYGIDGDARILGVAPM
FHITGFVMHLALSIAARATLILFGRFDPARALATIRAERPTWTVGAITAYNALAGLGEVT
REDFASFRRMDSGGAPIAPALRATIADTIGHAVYAAYGMTETASVTHSCPVGVEVPVDPA
SGAFSVGIPFIGTEAMVADEAGRPVPVGETGEIWMRGRQIMAGYWNKPEETAATLTNGWM
RSGDVGFMDEQGWFYVVDRKKDCIIASGFKVWPREVEDALHTHPAVREAAVVGAPDAYRG
ETVVAHVSLRPGAAADEAALIAHCRDQLAAYKVPRAIRIAAELPKTATGKIQRNVLREAE
QSAAAA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaaccattatgcggcgaagccatggttaaggcttttccccgaagggcaaccc
catgaccaccaggcccgcttcggcgacatgctggcggcgttccgcgcggcggtggcggac
gcggcggaccggacggcgatccgcttttcgggcagcggcatcagcttcggcgcgctggat
gccaagagcgatcgcctggccggttgggcggccgcgcacggggtcaagcccggggatcgc
atcgccatcatccttcagaacgtgcccgccgccgcgatcgcgacggtggcggcgtggaag
ctgggcgccatcccggtgccgggcaaccccatgtatcgcgcggccgagatcgcccgccag
ttcgaggacagccgccccgctttgctgatctgccacgaaggccatgccgcaaccatcggc
gaggcgctggcgatcatcggcgacggtggccggccggtgctgacggtgcccgaggacggc
gggccgggcgacgccgccctccccggcagccttgccgccgcgatggcggaagaactggtg
ccgccaccctctcccaccatcgcgccggacgacctcggcctgctgctctatacctccggc
acgacgggcgttcccaaggcggccatgatccgccacgaaagcctcgcctggaacagcgag
gcgatgtcgctctggtatgggatagacggcgatgcccgcatcttgggcgtggcgccgatg
ttccacatcaccggcttcgtcatgcacctcgctctgtcgatcgcggcgcgggcgacgctg
atcctgttcggccgcttcgatccggccagggcgctcgccaccatccgcgcggaacggccg
acatggacggtgggcgccatcaccgcctacaacgcgctggccgggctgggcgaggtgacg
cgcgaggatttcgccagcttccggcggatggattctggcggcgcgccgatcgcgcccgcg
ctccgcgccacgatcgccgacacgatcggccacgccgtctatgccgcctatggcatgacc
gaaacggcctccgtcacccatagctgcccggtgggcgtcgaggtgcccgtcgatcccgca
tcgggcgccttctccgtcggcatccccttcatcggcaccgaggcgatggtggcggacgag
gccggccggcccgtgcccgtcggcgagaccggcgagatatggatgcgcggccgccagatc
atggccggctattggaacaagcccgaggagacggcggccacgctgaccaatggctggatg
cgatccggcgatgtcggcttcatggacgagcaaggctggttctacgtcgtcgaccgcaag
aaggactgcatcatcgcttccggcttcaaggtatggccgcgcgaggtggaggatgcgctc
cacacccatccggcggtgcgcgaggcggccgtggtgggcgcgccggatgcctatcgcggc
gaaacggtggtggcgcacgtctcgctgcggcccggcgccgcggcggacgaggcggcgctg
atcgcccattgccgcgatcagcttgccgcctacaaggtgccccgcgccatccgcatcgcc
gccgaactgcccaagaccgcaaccggcaagatccagcgcaacgtgctgcgcgaggcggag
cagagcgcggccgcggcatag

DBGET integrated database retrieval system